Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9Z288

Protein Details
Accession A0A0C9Z288    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23DVWINGKNTKKKPNTKTIAKLVVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 20.5, cyto_mito 13, mito 4.5
Family & Domain DBs
Amino Acid Sequences DVWINGKNTKKKPNTKTIAKLVVFLHGLWLEGSVKIKWGRGSMHLEGARAEGMGAPDEGGAGED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.82
3 0.82
4 0.8
5 0.79
6 0.69
7 0.64
8 0.53
9 0.47
10 0.38
11 0.29
12 0.23
13 0.13
14 0.13
15 0.1
16 0.1
17 0.07
18 0.07
19 0.09
20 0.07
21 0.1
22 0.1
23 0.12
24 0.13
25 0.15
26 0.16
27 0.19
28 0.26
29 0.24
30 0.31
31 0.3
32 0.29
33 0.28
34 0.27
35 0.22
36 0.16
37 0.14
38 0.08
39 0.08
40 0.08
41 0.08
42 0.07
43 0.07
44 0.07