Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9ZKL1

Protein Details
Accession A0A0C9ZKL1   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-23LSLRTLCQRKSRIRVIRVRSALHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR017789  Frataxin  
IPR002908  Frataxin/CyaY  
IPR036524  Frataxin/CyaY_sf  
IPR020895  Frataxin_CS  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0008199  F:ferric iron binding  
GO:0004322  F:ferroxidase activity  
GO:0006783  P:heme biosynthetic process  
GO:0006879  P:intracellular iron ion homeostasis  
GO:0034755  P:iron ion transmembrane transport  
GO:0016226  P:iron-sulfur cluster assembly  
Pfam View protein in Pfam  
PF01491  Frataxin_Cyay  
PROSITE View protein in PROSITE  
PS01344  FRATAXIN_1  
PS50810  FRATAXIN_2  
Amino Acid Sequences MLSLRTLCQRKSRIRVIRVRSALIVPSTKLTLAFSSGGDARRWGSITDRRALTTRAPQTSINGLHIEEYGSLSEATMTRLLERLEDLLDELGNNDAEVDYHSGVLTLKLGPHGTYVINKQPPNKQIWLSSPISGPKRYDYVRGTDDWRYSRDGEELGTLLERELSETLGRDVRLGLARVSDLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.81
3 0.8
4 0.81
5 0.75
6 0.69
7 0.6
8 0.52
9 0.45
10 0.39
11 0.33
12 0.24
13 0.22
14 0.21
15 0.19
16 0.17
17 0.16
18 0.13
19 0.14
20 0.14
21 0.12
22 0.13
23 0.16
24 0.17
25 0.16
26 0.17
27 0.15
28 0.16
29 0.17
30 0.15
31 0.19
32 0.24
33 0.28
34 0.33
35 0.33
36 0.33
37 0.34
38 0.35
39 0.33
40 0.34
41 0.37
42 0.33
43 0.35
44 0.33
45 0.34
46 0.37
47 0.34
48 0.27
49 0.21
50 0.19
51 0.17
52 0.17
53 0.15
54 0.09
55 0.09
56 0.07
57 0.07
58 0.06
59 0.05
60 0.06
61 0.06
62 0.07
63 0.08
64 0.08
65 0.07
66 0.09
67 0.09
68 0.09
69 0.09
70 0.08
71 0.07
72 0.07
73 0.07
74 0.05
75 0.05
76 0.05
77 0.05
78 0.04
79 0.04
80 0.04
81 0.04
82 0.03
83 0.03
84 0.04
85 0.06
86 0.05
87 0.06
88 0.06
89 0.06
90 0.06
91 0.06
92 0.06
93 0.05
94 0.05
95 0.06
96 0.07
97 0.07
98 0.07
99 0.08
100 0.08
101 0.1
102 0.13
103 0.19
104 0.25
105 0.26
106 0.3
107 0.35
108 0.39
109 0.42
110 0.43
111 0.38
112 0.35
113 0.38
114 0.4
115 0.36
116 0.33
117 0.3
118 0.33
119 0.35
120 0.34
121 0.31
122 0.27
123 0.31
124 0.31
125 0.35
126 0.31
127 0.34
128 0.34
129 0.35
130 0.36
131 0.36
132 0.39
133 0.36
134 0.35
135 0.33
136 0.31
137 0.3
138 0.28
139 0.24
140 0.2
141 0.18
142 0.16
143 0.14
144 0.13
145 0.11
146 0.09
147 0.1
148 0.09
149 0.09
150 0.09
151 0.1
152 0.11
153 0.12
154 0.15
155 0.17
156 0.17
157 0.15
158 0.16
159 0.18
160 0.21
161 0.21
162 0.19
163 0.17