Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9YZT9

Protein Details
Accession A0A0C9YZT9   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
74-107RDRGTDKWYNRQRSEEKRRKKEEKESIRRLSKQFBasic
NLS Segment(s)
PositionSequence
86-105RSEEKRRKKEEKESIRRLSK
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028018  DUF4646  
Pfam View protein in Pfam  
PF15496  DUF4646  
Amino Acid Sequences PQPYSQSSGGQIQPGAITYTTSTGPDGQTVYHPFNYQTPQGVVSGIQWIPAEATSILPAGAQPATAEFAASWGRDRGTDKWYNRQRSEEKRRKKEEKESIRRLSKQFEKDREENEVRIQRERRRSFYGDGTPPFSPGHSVYSHSPTNELDRKFNDLDIDGRSAVYGNRPRKYSTAGGDRMYGAPPVEAGYAGSAGSAGSAAYAGAGSTSPYRQPAYTTSPNIRPQDTSFYPGGPDPITRATSPYARGNDPIARAASPYGRPPTEPIARASSPYGRPLNEPIARATSPYGRPLTEPISRAPSPYHPGYVPRAPSPIPPRAPSPYSAAHSPYVPRAPSPLPGRAPSPYAKPPPPYLSGAPSPYLPPQASQVYPPGHVMDGQPFPRSRAPSPMPGPPAAFPTSPRMPVSVAGADQQLSAPDAFSRPANAAQPYTPFNPMKIQDMEQFYDQIPRMPLVLDTHDVYHQDWIRFMNDLALGWAGRLPLPDLSRGPPPRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.14
4 0.13
5 0.12
6 0.14
7 0.14
8 0.14
9 0.15
10 0.15
11 0.16
12 0.17
13 0.17
14 0.16
15 0.21
16 0.25
17 0.28
18 0.28
19 0.28
20 0.28
21 0.32
22 0.36
23 0.33
24 0.32
25 0.29
26 0.28
27 0.27
28 0.26
29 0.21
30 0.17
31 0.21
32 0.16
33 0.16
34 0.15
35 0.14
36 0.15
37 0.14
38 0.15
39 0.1
40 0.1
41 0.1
42 0.1
43 0.09
44 0.08
45 0.08
46 0.08
47 0.08
48 0.07
49 0.07
50 0.07
51 0.1
52 0.1
53 0.1
54 0.07
55 0.1
56 0.12
57 0.12
58 0.13
59 0.13
60 0.13
61 0.16
62 0.2
63 0.21
64 0.28
65 0.36
66 0.38
67 0.47
68 0.57
69 0.63
70 0.63
71 0.69
72 0.7
73 0.73
74 0.8
75 0.8
76 0.81
77 0.83
78 0.9
79 0.9
80 0.9
81 0.9
82 0.89
83 0.9
84 0.9
85 0.9
86 0.89
87 0.88
88 0.85
89 0.78
90 0.75
91 0.73
92 0.72
93 0.71
94 0.7
95 0.7
96 0.68
97 0.68
98 0.68
99 0.63
100 0.55
101 0.54
102 0.51
103 0.45
104 0.48
105 0.52
106 0.51
107 0.58
108 0.62
109 0.59
110 0.6
111 0.63
112 0.59
113 0.6
114 0.6
115 0.57
116 0.53
117 0.51
118 0.44
119 0.41
120 0.37
121 0.29
122 0.23
123 0.17
124 0.18
125 0.15
126 0.18
127 0.2
128 0.25
129 0.26
130 0.24
131 0.24
132 0.22
133 0.29
134 0.32
135 0.31
136 0.3
137 0.3
138 0.36
139 0.35
140 0.34
141 0.28
142 0.22
143 0.22
144 0.2
145 0.2
146 0.15
147 0.14
148 0.13
149 0.12
150 0.12
151 0.17
152 0.23
153 0.28
154 0.31
155 0.33
156 0.35
157 0.37
158 0.42
159 0.39
160 0.37
161 0.4
162 0.39
163 0.39
164 0.38
165 0.37
166 0.33
167 0.28
168 0.22
169 0.13
170 0.09
171 0.09
172 0.08
173 0.07
174 0.06
175 0.05
176 0.05
177 0.05
178 0.05
179 0.05
180 0.04
181 0.03
182 0.03
183 0.03
184 0.03
185 0.02
186 0.02
187 0.02
188 0.02
189 0.02
190 0.02
191 0.02
192 0.03
193 0.03
194 0.05
195 0.06
196 0.06
197 0.09
198 0.1
199 0.1
200 0.12
201 0.15
202 0.22
203 0.27
204 0.3
205 0.32
206 0.38
207 0.44
208 0.44
209 0.41
210 0.35
211 0.31
212 0.35
213 0.32
214 0.29
215 0.23
216 0.21
217 0.21
218 0.2
219 0.19
220 0.12
221 0.11
222 0.09
223 0.11
224 0.13
225 0.12
226 0.13
227 0.14
228 0.15
229 0.18
230 0.21
231 0.21
232 0.2
233 0.21
234 0.22
235 0.23
236 0.22
237 0.21
238 0.17
239 0.14
240 0.14
241 0.14
242 0.14
243 0.12
244 0.15
245 0.16
246 0.16
247 0.16
248 0.18
249 0.24
250 0.25
251 0.26
252 0.24
253 0.27
254 0.27
255 0.27
256 0.27
257 0.26
258 0.23
259 0.27
260 0.27
261 0.22
262 0.23
263 0.26
264 0.31
265 0.29
266 0.29
267 0.25
268 0.26
269 0.26
270 0.25
271 0.23
272 0.21
273 0.19
274 0.23
275 0.23
276 0.19
277 0.2
278 0.22
279 0.25
280 0.23
281 0.24
282 0.21
283 0.27
284 0.26
285 0.27
286 0.26
287 0.25
288 0.26
289 0.26
290 0.27
291 0.2
292 0.24
293 0.28
294 0.3
295 0.29
296 0.25
297 0.26
298 0.25
299 0.3
300 0.33
301 0.36
302 0.35
303 0.34
304 0.37
305 0.39
306 0.4
307 0.36
308 0.34
309 0.31
310 0.3
311 0.3
312 0.29
313 0.25
314 0.25
315 0.24
316 0.24
317 0.24
318 0.21
319 0.19
320 0.21
321 0.21
322 0.27
323 0.3
324 0.32
325 0.31
326 0.32
327 0.34
328 0.31
329 0.34
330 0.29
331 0.31
332 0.32
333 0.36
334 0.39
335 0.41
336 0.44
337 0.45
338 0.46
339 0.45
340 0.39
341 0.37
342 0.37
343 0.35
344 0.31
345 0.27
346 0.25
347 0.23
348 0.25
349 0.2
350 0.17
351 0.19
352 0.22
353 0.22
354 0.22
355 0.26
356 0.24
357 0.24
358 0.25
359 0.22
360 0.18
361 0.19
362 0.18
363 0.18
364 0.21
365 0.22
366 0.25
367 0.24
368 0.28
369 0.32
370 0.36
371 0.32
372 0.36
373 0.39
374 0.44
375 0.47
376 0.5
377 0.48
378 0.45
379 0.45
380 0.37
381 0.37
382 0.31
383 0.28
384 0.23
385 0.27
386 0.29
387 0.3
388 0.3
389 0.27
390 0.25
391 0.26
392 0.28
393 0.23
394 0.19
395 0.18
396 0.18
397 0.16
398 0.15
399 0.14
400 0.11
401 0.1
402 0.09
403 0.08
404 0.09
405 0.09
406 0.11
407 0.11
408 0.12
409 0.13
410 0.16
411 0.2
412 0.22
413 0.23
414 0.23
415 0.26
416 0.29
417 0.3
418 0.34
419 0.3
420 0.29
421 0.34
422 0.34
423 0.37
424 0.36
425 0.36
426 0.36
427 0.4
428 0.41
429 0.36
430 0.36
431 0.3
432 0.33
433 0.3
434 0.28
435 0.24
436 0.22
437 0.21
438 0.2
439 0.21
440 0.18
441 0.22
442 0.2
443 0.2
444 0.21
445 0.23
446 0.24
447 0.23
448 0.27
449 0.28
450 0.26
451 0.27
452 0.27
453 0.27
454 0.27
455 0.26
456 0.22
457 0.18
458 0.17
459 0.17
460 0.16
461 0.15
462 0.13
463 0.14
464 0.11
465 0.11
466 0.12
467 0.12
468 0.16
469 0.18
470 0.22
471 0.24
472 0.27
473 0.36