Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9YL74

Protein Details
Accession A0A0C9YL74    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
4-34IPKTRRTYCQGKTCRKHTPHKVTQYKKGKDSHydrophilic
74-93CTVCKHKKQLALKRCKHFELHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 7, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRRTYCQGKTCRKHTPHKVTQYKKGKDSLSAQGKRRYDRKQSGYGGQTKQIFHKKAKTTKKVVLKLECTVCKHKKQLALKRCKHFELGGEKKTKGAALTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.78
3 0.8
4 0.83
5 0.81
6 0.82
7 0.83
8 0.83
9 0.82
10 0.84
11 0.87
12 0.84
13 0.87
14 0.87
15 0.82
16 0.75
17 0.71
18 0.61
19 0.56
20 0.54
21 0.53
22 0.53
23 0.53
24 0.54
25 0.55
26 0.58
27 0.58
28 0.6
29 0.58
30 0.57
31 0.6
32 0.61
33 0.61
34 0.61
35 0.61
36 0.59
37 0.58
38 0.49
39 0.44
40 0.4
41 0.33
42 0.36
43 0.37
44 0.36
45 0.32
46 0.4
47 0.43
48 0.5
49 0.6
50 0.62
51 0.61
52 0.66
53 0.72
54 0.71
55 0.7
56 0.67
57 0.61
58 0.58
59 0.58
60 0.55
61 0.5
62 0.52
63 0.51
64 0.51
65 0.54
66 0.53
67 0.55
68 0.62
69 0.67
70 0.69
71 0.74
72 0.76
73 0.8
74 0.81
75 0.75
76 0.68
77 0.6
78 0.56
79 0.56
80 0.56
81 0.54
82 0.54
83 0.51
84 0.49
85 0.48
86 0.42