Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0ACT1

Protein Details
Accession A0A0D0ACT1   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
9-30GQALRDRRVRRQQKYYVKQPNAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto 6, cyto_nucl 5.333, cyto_pero 4.833, nucl 3.5
Family & Domain DBs
Amino Acid Sequences SLHRVDRIGQALRDRRVRRQQKYYVKQPNAVWHIDGHHKLICWGIVIHGFIDGFCCTIC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.57
3 0.63
4 0.71
5 0.7
6 0.73
7 0.77
8 0.79
9 0.84
10 0.85
11 0.85
12 0.77
13 0.74
14 0.66
15 0.64
16 0.56
17 0.47
18 0.37
19 0.27
20 0.27
21 0.27
22 0.26
23 0.2
24 0.18
25 0.17
26 0.17
27 0.18
28 0.15
29 0.11
30 0.1
31 0.09
32 0.1
33 0.11
34 0.11
35 0.11
36 0.1
37 0.09
38 0.11
39 0.1