Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9YQF6

Protein Details
Accession A0A0C9YQF6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
46-67APKTAKACKDKWKRLRKTYDAVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, extr 9, pero 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR044822  Myb_DNA-bind_4  
IPR001005  SANT/Myb  
Pfam View protein in Pfam  
PF13837  Myb_DNA-bind_4  
PROSITE View protein in PROSITE  
PS50090  MYB_LIKE  
Amino Acid Sequences SWSEADTITLLNLVVAHKALAGEGLNFKATFWNTAAAHLGNPSKGAPKTAKACKDKWKRLRKTYDAVDQLCSRSGFAYSLKSGANIGIENEQLWNAFQYKDAAPFRNKGWLYYDKMKEIMPLKAKGLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.07
5 0.07
6 0.07
7 0.07
8 0.07
9 0.08
10 0.09
11 0.1
12 0.11
13 0.11
14 0.12
15 0.14
16 0.14
17 0.15
18 0.14
19 0.19
20 0.17
21 0.19
22 0.21
23 0.17
24 0.16
25 0.17
26 0.17
27 0.12
28 0.12
29 0.12
30 0.15
31 0.14
32 0.18
33 0.17
34 0.21
35 0.29
36 0.35
37 0.43
38 0.43
39 0.48
40 0.55
41 0.64
42 0.69
43 0.72
44 0.75
45 0.76
46 0.81
47 0.85
48 0.8
49 0.76
50 0.71
51 0.69
52 0.63
53 0.55
54 0.48
55 0.39
56 0.34
57 0.3
58 0.24
59 0.17
60 0.11
61 0.11
62 0.1
63 0.1
64 0.12
65 0.1
66 0.12
67 0.12
68 0.12
69 0.12
70 0.11
71 0.11
72 0.08
73 0.09
74 0.08
75 0.09
76 0.09
77 0.09
78 0.08
79 0.07
80 0.08
81 0.08
82 0.08
83 0.08
84 0.09
85 0.12
86 0.13
87 0.21
88 0.24
89 0.28
90 0.3
91 0.32
92 0.33
93 0.39
94 0.38
95 0.32
96 0.35
97 0.37
98 0.41
99 0.48
100 0.51
101 0.45
102 0.46
103 0.45
104 0.44
105 0.41
106 0.41
107 0.38
108 0.37