Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0AC18

Protein Details
Accession A0A0D0AC18    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MEWRSTKRDRVKQLRVLVGRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, E.R. 6, plas 4, cyto 3, extr 2, cyto_nucl 2
Family & Domain DBs
Amino Acid Sequences MEWRSTKRDRVKQLRVLVGRQLEFGKERFLPGCADGGVIVVEVCCVLELVIVGATNLRVDTRVPFPGSVFAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.74
3 0.67
4 0.62
5 0.56
6 0.46
7 0.4
8 0.32
9 0.25
10 0.24
11 0.22
12 0.2
13 0.15
14 0.16
15 0.15
16 0.15
17 0.15
18 0.13
19 0.14
20 0.1
21 0.1
22 0.08
23 0.07
24 0.06
25 0.05
26 0.04
27 0.03
28 0.03
29 0.03
30 0.03
31 0.02
32 0.02
33 0.02
34 0.02
35 0.03
36 0.03
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.05
44 0.05
45 0.05
46 0.06
47 0.1
48 0.14
49 0.19
50 0.21
51 0.22
52 0.23