Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9ZJC8

Protein Details
Accession A0A0C9ZJC8    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
55-75PQSRWRYQKIGKSRRRYMLERHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 8.833, nucl 8, cyto 7.5, cyto_pero 7.166, pero 5.5, mito 3, cysk 3
Family & Domain DBs
Amino Acid Sequences MATNKVDGSKTLMVTIHAGTCCFDRMSDSGQPGSTEKDEIVNRIVEAANMNVDAPQSRWRYQKIGKSRRRYMLERLDIGRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.18
4 0.15
5 0.15
6 0.13
7 0.14
8 0.14
9 0.13
10 0.12
11 0.11
12 0.12
13 0.17
14 0.19
15 0.2
16 0.19
17 0.19
18 0.2
19 0.19
20 0.19
21 0.15
22 0.13
23 0.11
24 0.15
25 0.15
26 0.15
27 0.16
28 0.13
29 0.12
30 0.13
31 0.13
32 0.08
33 0.08
34 0.08
35 0.06
36 0.06
37 0.06
38 0.05
39 0.06
40 0.06
41 0.07
42 0.14
43 0.18
44 0.22
45 0.27
46 0.3
47 0.38
48 0.44
49 0.52
50 0.56
51 0.63
52 0.69
53 0.74
54 0.8
55 0.82
56 0.82
57 0.78
58 0.76
59 0.76
60 0.74
61 0.7