Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9ZGM5

Protein Details
Accession A0A0C9ZGM5    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
14-35GISLGRSLRKRRRRLYPFLFSGHydrophilic
NLS Segment(s)
PositionSequence
22-26RKRRR
Subcellular Location(s) nucl 11, mito_nucl 10.5, mito 8, cyto 4, plas 3
Family & Domain DBs
Amino Acid Sequences MVDPSHLTTTPEWGISLGRSLRKRRRRLYPFLFSGIPFFQKKVAMSSDLPLECVMHALTQRLSIRWEVLLLEGSSEAKSVFNMADIDVINKVSRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.19
4 0.18
5 0.23
6 0.3
7 0.39
8 0.49
9 0.58
10 0.67
11 0.71
12 0.78
13 0.8
14 0.83
15 0.83
16 0.81
17 0.75
18 0.69
19 0.62
20 0.51
21 0.45
22 0.35
23 0.3
24 0.21
25 0.18
26 0.16
27 0.16
28 0.17
29 0.16
30 0.16
31 0.16
32 0.16
33 0.16
34 0.19
35 0.17
36 0.17
37 0.14
38 0.13
39 0.1
40 0.1
41 0.09
42 0.06
43 0.06
44 0.07
45 0.07
46 0.11
47 0.12
48 0.12
49 0.14
50 0.14
51 0.14
52 0.13
53 0.14
54 0.1
55 0.1
56 0.11
57 0.09
58 0.09
59 0.09
60 0.09
61 0.09
62 0.09
63 0.08
64 0.06
65 0.07
66 0.07
67 0.07
68 0.08
69 0.09
70 0.09
71 0.11
72 0.11
73 0.13
74 0.12
75 0.14