Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9ZJ98

Protein Details
Accession A0A0C9ZJ98    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
141-173HETRKARPTLRYLRRRSRMVRLRYRPIRAPRLHBasic
NLS Segment(s)
PositionSequence
145-171KARPTLRYLRRRSRMVRLRYRPIRAPR
Subcellular Location(s) mito 21, cyto 4
Family & Domain DBs
Amino Acid Sequences MRGTKWKPRFGPQGPQSRSPLSRGVCEPLQRQLGRLWRVFGARSGGRGSHVLRGRLPRGIRNRWTSYSVKEDGVEVRWENVHLRRVARARVLVLRVTCIHVYILARAHDPLFACIDVCFLPQLPQRLLTLALLNTARITWHETRKARPTLRYLRRRSRMVRLRYRPIRAPRLHE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.73
3 0.68
4 0.64
5 0.6
6 0.52
7 0.51
8 0.42
9 0.42
10 0.39
11 0.4
12 0.37
13 0.4
14 0.39
15 0.38
16 0.44
17 0.39
18 0.38
19 0.38
20 0.43
21 0.43
22 0.42
23 0.37
24 0.32
25 0.33
26 0.33
27 0.29
28 0.27
29 0.22
30 0.23
31 0.22
32 0.2
33 0.2
34 0.22
35 0.22
36 0.23
37 0.26
38 0.26
39 0.28
40 0.33
41 0.33
42 0.36
43 0.36
44 0.36
45 0.41
46 0.47
47 0.5
48 0.52
49 0.55
50 0.53
51 0.56
52 0.51
53 0.46
54 0.44
55 0.39
56 0.32
57 0.27
58 0.25
59 0.21
60 0.21
61 0.19
62 0.13
63 0.11
64 0.11
65 0.11
66 0.13
67 0.15
68 0.17
69 0.17
70 0.18
71 0.22
72 0.24
73 0.25
74 0.25
75 0.23
76 0.2
77 0.21
78 0.22
79 0.19
80 0.17
81 0.17
82 0.16
83 0.17
84 0.15
85 0.12
86 0.11
87 0.1
88 0.11
89 0.1
90 0.12
91 0.11
92 0.11
93 0.12
94 0.12
95 0.12
96 0.12
97 0.11
98 0.1
99 0.1
100 0.09
101 0.09
102 0.1
103 0.08
104 0.08
105 0.08
106 0.06
107 0.1
108 0.13
109 0.17
110 0.17
111 0.18
112 0.18
113 0.19
114 0.2
115 0.17
116 0.16
117 0.12
118 0.14
119 0.13
120 0.13
121 0.12
122 0.11
123 0.1
124 0.09
125 0.16
126 0.18
127 0.26
128 0.35
129 0.39
130 0.46
131 0.55
132 0.63
133 0.62
134 0.62
135 0.65
136 0.67
137 0.73
138 0.77
139 0.78
140 0.8
141 0.83
142 0.85
143 0.82
144 0.82
145 0.81
146 0.81
147 0.83
148 0.81
149 0.84
150 0.84
151 0.85
152 0.83
153 0.83
154 0.83