Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9Z9W3

Protein Details
Accession A0A0C9Z9W3   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
46-65PKTAKACKERWQRMKKTFDVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, cyto 9, pero 5, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR024752  Myb/SANT-like_dom  
IPR001005  SANT/Myb  
Pfam View protein in Pfam  
PF12776  Myb_DNA-bind_3  
PROSITE View protein in PROSITE  
PS50090  MYB_LIKE  
CDD cd00167  SANT  
Amino Acid Sequences WTDAESDMLLDIISAHKASAGDGLNFKMTFWNTAAAQLPGPTKGAPKTAKACKERWQRMKKTFDVVDRIANASGFTYSRESGASIGLENEGVWTDFVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.08
5 0.08
6 0.12
7 0.13
8 0.14
9 0.15
10 0.16
11 0.18
12 0.18
13 0.17
14 0.16
15 0.15
16 0.15
17 0.15
18 0.16
19 0.14
20 0.16
21 0.17
22 0.14
23 0.14
24 0.14
25 0.13
26 0.11
27 0.12
28 0.1
29 0.11
30 0.11
31 0.17
32 0.17
33 0.21
34 0.27
35 0.33
36 0.4
37 0.42
38 0.44
39 0.47
40 0.56
41 0.62
42 0.66
43 0.7
44 0.71
45 0.76
46 0.8
47 0.74
48 0.7
49 0.64
50 0.58
51 0.54
52 0.47
53 0.41
54 0.35
55 0.34
56 0.27
57 0.23
58 0.18
59 0.13
60 0.12
61 0.09
62 0.1
63 0.11
64 0.11
65 0.12
66 0.13
67 0.13
68 0.12
69 0.13
70 0.12
71 0.1
72 0.1
73 0.1
74 0.09
75 0.08
76 0.08
77 0.08
78 0.08