Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9ZLY4

Protein Details
Accession A0A0C9ZLY4    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-35YAALCGPVERKRKKERERRYGFQRIPRBasic
NLS Segment(s)
PositionSequence
18-27RKRKKERERR
Subcellular Location(s) mito 15, nucl 6.5, cyto_nucl 5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MTRERRACYAALCGPVERKRKKERERRYGFQRIPRLSYPYLAPLTRQTKTLALIPFSNSFPFLGICLIHPHRTPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.39
3 0.47
4 0.47
5 0.51
6 0.57
7 0.67
8 0.76
9 0.8
10 0.84
11 0.85
12 0.88
13 0.88
14 0.86
15 0.86
16 0.81
17 0.79
18 0.76
19 0.67
20 0.63
21 0.56
22 0.52
23 0.42
24 0.37
25 0.3
26 0.25
27 0.24
28 0.2
29 0.19
30 0.21
31 0.26
32 0.25
33 0.26
34 0.23
35 0.23
36 0.25
37 0.29
38 0.24
39 0.21
40 0.21
41 0.23
42 0.24
43 0.23
44 0.22
45 0.18
46 0.16
47 0.15
48 0.14
49 0.11
50 0.1
51 0.09
52 0.1
53 0.17
54 0.21
55 0.24