Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9ZHS8

Protein Details
Accession A0A0C9ZHS8    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
17-36PNPHRPTQSTCKKRNPSLLSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7, nucl 5, plas 5, E.R. 3, golg 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR024512  Ser_palmitoyltrfase_ssu-like  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
Pfam View protein in Pfam  
PF11779  SPT_ssu-like  
Amino Acid Sequences MCPVKRELPDCSLLQTPNPHRPTQSTCKKRNPSLLSNLTLTSILSIPMLTTSSRLRHYLWRRKILIETTFAINALEPWEKMIFFSVLSLLLFLLFRGICRIFPSQLVVVQQRAAYYLWGTTPRTGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.37
3 0.39
4 0.44
5 0.47
6 0.45
7 0.43
8 0.48
9 0.52
10 0.54
11 0.58
12 0.59
13 0.64
14 0.73
15 0.79
16 0.8
17 0.82
18 0.78
19 0.74
20 0.73
21 0.7
22 0.62
23 0.55
24 0.49
25 0.39
26 0.32
27 0.25
28 0.16
29 0.1
30 0.08
31 0.06
32 0.06
33 0.05
34 0.05
35 0.06
36 0.05
37 0.07
38 0.09
39 0.12
40 0.14
41 0.16
42 0.17
43 0.26
44 0.36
45 0.44
46 0.5
47 0.54
48 0.54
49 0.54
50 0.55
51 0.5
52 0.42
53 0.34
54 0.28
55 0.22
56 0.2
57 0.19
58 0.16
59 0.11
60 0.09
61 0.09
62 0.08
63 0.07
64 0.08
65 0.09
66 0.09
67 0.09
68 0.1
69 0.08
70 0.07
71 0.08
72 0.07
73 0.07
74 0.07
75 0.07
76 0.05
77 0.05
78 0.05
79 0.04
80 0.06
81 0.06
82 0.06
83 0.1
84 0.1
85 0.11
86 0.14
87 0.18
88 0.17
89 0.18
90 0.22
91 0.2
92 0.22
93 0.26
94 0.25
95 0.23
96 0.23
97 0.23
98 0.19
99 0.19
100 0.17
101 0.14
102 0.12
103 0.12
104 0.13
105 0.17
106 0.19