Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9YGC9

Protein Details
Accession A0A0C9YGC9    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
88-117EAKNTRTLANRSKRKRRRKGKVSAEEREQSHydrophilic
NLS Segment(s)
PositionSequence
97-108NRSKRKRRRKGK
Subcellular Location(s) cyto_nucl 10.166, mito_nucl 9.832, cyto_mito 9.332, nucl 9, mito 9, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036882  Alba-like_dom_sf  
IPR014612  Pop7/Rpp20  
Gene Ontology GO:0005655  C:nucleolar ribonuclease P complex  
GO:0000172  C:ribonuclease MRP complex  
GO:0003676  F:nucleic acid binding  
GO:0004526  F:ribonuclease P activity  
GO:0001682  P:tRNA 5'-leader removal  
Pfam View protein in Pfam  
PF12328  Rpp20  
Amino Acid Sequences MGAAIPHLALLVGSLTTEGILPFAQDELKVEVYTGSEGVVDEVLSNSESESEGDGRVEDTPKEEFRQRTKSTMHVTIRHENGNAIPAEAKNTRTLANRSKRKRRRKGKVSAEEREQSGVDAPQRIVIQEPEQEDSNGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.05
9 0.05
10 0.06
11 0.06
12 0.06
13 0.08
14 0.11
15 0.12
16 0.12
17 0.12
18 0.12
19 0.12
20 0.13
21 0.1
22 0.07
23 0.06
24 0.06
25 0.06
26 0.06
27 0.05
28 0.04
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.06
36 0.06
37 0.07
38 0.07
39 0.07
40 0.07
41 0.07
42 0.07
43 0.08
44 0.09
45 0.07
46 0.09
47 0.11
48 0.12
49 0.15
50 0.19
51 0.22
52 0.27
53 0.35
54 0.35
55 0.37
56 0.38
57 0.41
58 0.41
59 0.45
60 0.43
61 0.4
62 0.44
63 0.45
64 0.46
65 0.41
66 0.37
67 0.29
68 0.25
69 0.23
70 0.18
71 0.12
72 0.11
73 0.1
74 0.14
75 0.14
76 0.15
77 0.14
78 0.15
79 0.18
80 0.21
81 0.27
82 0.32
83 0.41
84 0.5
85 0.58
86 0.69
87 0.76
88 0.84
89 0.89
90 0.91
91 0.92
92 0.92
93 0.93
94 0.93
95 0.94
96 0.92
97 0.88
98 0.84
99 0.77
100 0.67
101 0.58
102 0.47
103 0.37
104 0.3
105 0.25
106 0.21
107 0.2
108 0.18
109 0.2
110 0.2
111 0.2
112 0.2
113 0.2
114 0.21
115 0.23
116 0.25
117 0.25
118 0.26