Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9YW19

Protein Details
Accession A0A0C9YW19   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
49-69APKTAKACKDKWKRLRKTYDAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, extr 5, pero 5, cyto 3.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR044822  Myb_DNA-bind_4  
IPR001005  SANT/Myb  
Pfam View protein in Pfam  
PF13837  Myb_DNA-bind_4  
PROSITE View protein in PROSITE  
PS50090  MYB_LIKE  
Amino Acid Sequences MQVSWSEADTITLLDLVVTHKALAGEGLNFKATFWNTAAVHLRNPSKGAPKTAKACKDKWKRLRKTYDAVDQLCSRSGFVYSLKSGANIGIENEQLWNAFVRQYKDAAPFRNKGWLYYDKMKEIMPSKAKGLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.08
5 0.08
6 0.07
7 0.09
8 0.09
9 0.09
10 0.09
11 0.09
12 0.09
13 0.11
14 0.12
15 0.12
16 0.12
17 0.12
18 0.15
19 0.15
20 0.15
21 0.14
22 0.18
23 0.17
24 0.21
25 0.26
26 0.23
27 0.25
28 0.27
29 0.28
30 0.24
31 0.25
32 0.24
33 0.28
34 0.29
35 0.34
36 0.34
37 0.37
38 0.44
39 0.49
40 0.55
41 0.51
42 0.54
43 0.58
44 0.64
45 0.69
46 0.71
47 0.75
48 0.76
49 0.81
50 0.85
51 0.8
52 0.76
53 0.71
54 0.68
55 0.63
56 0.54
57 0.48
58 0.39
59 0.34
60 0.3
61 0.24
62 0.17
63 0.11
64 0.11
65 0.1
66 0.1
67 0.12
68 0.1
69 0.12
70 0.12
71 0.12
72 0.12
73 0.11
74 0.11
75 0.08
76 0.09
77 0.08
78 0.09
79 0.08
80 0.09
81 0.08
82 0.07
83 0.08
84 0.07
85 0.06
86 0.1
87 0.13
88 0.16
89 0.18
90 0.2
91 0.23
92 0.3
93 0.35
94 0.39
95 0.42
96 0.42
97 0.42
98 0.49
99 0.46
100 0.39
101 0.41
102 0.4
103 0.41
104 0.48
105 0.51
106 0.45
107 0.46
108 0.45
109 0.44
110 0.42
111 0.43
112 0.4
113 0.38