Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9YY15

Protein Details
Accession A0A0C9YY15   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
132-157GQDGRKQRFKVSKNARRKPDRPIGIPBasic
NLS Segment(s)
PositionSequence
136-153RKQRFKVSKNARRKPDRP
Subcellular Location(s) nucl 15, cyto_nucl 12.5, cyto 8, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR026894  DnaJ_X  
Pfam View protein in Pfam  
PF14308  DnaJ-X  
Amino Acid Sequences MKRMPVTSGGLIDQKLWDEEKIKVYHEAEELRSTSFGLQLLYVISTSYHRSSEGSVNGPTRALKISIIRSLIQDVGTLEEKLATVEDEDEKRALEEDIAGKILLACWRGVRSEIEKILSKVANHIITDARVGQDGRKQRFKVSKNARRKPDRPIGIPAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.17
4 0.16
5 0.16
6 0.19
7 0.25
8 0.26
9 0.27
10 0.3
11 0.3
12 0.31
13 0.32
14 0.32
15 0.27
16 0.29
17 0.28
18 0.23
19 0.22
20 0.2
21 0.16
22 0.15
23 0.13
24 0.1
25 0.09
26 0.08
27 0.08
28 0.08
29 0.07
30 0.06
31 0.06
32 0.07
33 0.1
34 0.11
35 0.11
36 0.12
37 0.12
38 0.15
39 0.19
40 0.2
41 0.2
42 0.21
43 0.22
44 0.22
45 0.21
46 0.19
47 0.16
48 0.14
49 0.12
50 0.11
51 0.13
52 0.16
53 0.18
54 0.19
55 0.19
56 0.18
57 0.19
58 0.18
59 0.14
60 0.12
61 0.09
62 0.09
63 0.1
64 0.09
65 0.08
66 0.07
67 0.07
68 0.07
69 0.07
70 0.04
71 0.04
72 0.05
73 0.07
74 0.08
75 0.09
76 0.09
77 0.09
78 0.09
79 0.09
80 0.08
81 0.06
82 0.07
83 0.07
84 0.08
85 0.09
86 0.08
87 0.07
88 0.07
89 0.08
90 0.08
91 0.08
92 0.08
93 0.08
94 0.09
95 0.1
96 0.12
97 0.14
98 0.16
99 0.21
100 0.23
101 0.25
102 0.26
103 0.27
104 0.3
105 0.29
106 0.25
107 0.23
108 0.26
109 0.25
110 0.23
111 0.24
112 0.2
113 0.19
114 0.21
115 0.18
116 0.13
117 0.13
118 0.13
119 0.14
120 0.2
121 0.28
122 0.34
123 0.42
124 0.43
125 0.5
126 0.59
127 0.61
128 0.66
129 0.68
130 0.71
131 0.74
132 0.82
133 0.84
134 0.85
135 0.84
136 0.83
137 0.83
138 0.81
139 0.75