Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9XZZ7

Protein Details
Accession A0A0C9XZZ7    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
42-63LTRAEKRRKIARRKAERHPDPLBasic
NLS Segment(s)
PositionSequence
44-62RAEKRRKIARRKAERHPDP
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MSQVDLRHIRARMQRSTSPDIPTSGPVYKPFHPYAKIAPDALTRAEKRRKIARRKAERHPDPLPTPPPSLPRASSHRKMNHSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.54
3 0.61
4 0.58
5 0.55
6 0.49
7 0.44
8 0.39
9 0.36
10 0.32
11 0.26
12 0.23
13 0.24
14 0.27
15 0.27
16 0.32
17 0.33
18 0.32
19 0.32
20 0.32
21 0.33
22 0.33
23 0.31
24 0.26
25 0.24
26 0.21
27 0.2
28 0.2
29 0.19
30 0.16
31 0.22
32 0.29
33 0.31
34 0.35
35 0.44
36 0.52
37 0.59
38 0.68
39 0.71
40 0.75
41 0.8
42 0.85
43 0.87
44 0.83
45 0.8
46 0.73
47 0.7
48 0.62
49 0.62
50 0.56
51 0.49
52 0.47
53 0.42
54 0.43
55 0.39
56 0.4
57 0.36
58 0.37
59 0.42
60 0.47
61 0.52
62 0.57
63 0.62