Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9YPX1

Protein Details
Accession A0A0C9YPX1    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-20KDESRLLKRKEQNRAAQRAFHydrophilic
NLS Segment(s)
PositionSequence
16-24AQRAFRERK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences KDESRLLKRKEQNRAAQRAFRERKEKHVKDLEDKVAALEAKYEETETENSNLRDLLSRLQQENVALR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.78
3 0.75
4 0.72
5 0.72
6 0.69
7 0.65
8 0.66
9 0.57
10 0.63
11 0.68
12 0.65
13 0.62
14 0.65
15 0.61
16 0.58
17 0.62
18 0.54
19 0.44
20 0.41
21 0.32
22 0.26
23 0.22
24 0.15
25 0.1
26 0.08
27 0.08
28 0.08
29 0.08
30 0.07
31 0.09
32 0.11
33 0.12
34 0.14
35 0.17
36 0.18
37 0.18
38 0.18
39 0.16
40 0.18
41 0.17
42 0.2
43 0.23
44 0.27
45 0.28
46 0.29
47 0.3