Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9XXX6

Protein Details
Accession A0A0C9XXX6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
28-49GPKTSKVCKEKWKRLRKTFEVIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, cyto 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR024752  Myb/SANT-like_dom  
Pfam View protein in Pfam  
PF12776  Myb_DNA-bind_3  
Amino Acid Sequences ATLGEGMNFKATFWNAVSNALSNPSKGGPKTSKVCKEKWKRLRKTFEVINCIKNTSGFAYSCELGANIGLENKAVWNDFIKVCAYIKNANLC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.18
3 0.21
4 0.22
5 0.19
6 0.19
7 0.22
8 0.21
9 0.16
10 0.17
11 0.16
12 0.19
13 0.18
14 0.25
15 0.24
16 0.3
17 0.37
18 0.44
19 0.52
20 0.53
21 0.59
22 0.62
23 0.69
24 0.73
25 0.76
26 0.79
27 0.79
28 0.84
29 0.87
30 0.82
31 0.77
32 0.72
33 0.67
34 0.64
35 0.56
36 0.5
37 0.42
38 0.37
39 0.31
40 0.25
41 0.21
42 0.16
43 0.16
44 0.12
45 0.13
46 0.15
47 0.15
48 0.15
49 0.14
50 0.11
51 0.09
52 0.09
53 0.08
54 0.05
55 0.06
56 0.06
57 0.06
58 0.06
59 0.07
60 0.08
61 0.08
62 0.08
63 0.1
64 0.13
65 0.13
66 0.15
67 0.16
68 0.16
69 0.17
70 0.2
71 0.22
72 0.23