Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9ZME3

Protein Details
Accession A0A0C9ZME3    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-29KNLPARRETYCKQKRRRRNIQGALAHGRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 10.166, nucl 10, mito 10, cyto_nucl 9.5
Family & Domain DBs
Amino Acid Sequences MKNLPARRETYCKQKRRRRNIQGALAHGRRGLSSVKAFVFCTSHYLDHIDRRRNPTWTTPIYVIGNIDYPPVTERDLTRARSGRDGPPPWWRDTRPTGRSITGPLSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.83
3 0.86
4 0.92
5 0.92
6 0.93
7 0.92
8 0.91
9 0.86
10 0.82
11 0.8
12 0.7
13 0.59
14 0.49
15 0.39
16 0.29
17 0.25
18 0.2
19 0.15
20 0.15
21 0.17
22 0.17
23 0.18
24 0.19
25 0.18
26 0.17
27 0.14
28 0.16
29 0.15
30 0.14
31 0.13
32 0.16
33 0.17
34 0.23
35 0.3
36 0.33
37 0.36
38 0.42
39 0.44
40 0.44
41 0.45
42 0.42
43 0.43
44 0.38
45 0.37
46 0.31
47 0.31
48 0.28
49 0.26
50 0.21
51 0.14
52 0.13
53 0.1
54 0.1
55 0.07
56 0.07
57 0.08
58 0.09
59 0.09
60 0.1
61 0.1
62 0.17
63 0.22
64 0.25
65 0.31
66 0.34
67 0.35
68 0.39
69 0.43
70 0.42
71 0.47
72 0.48
73 0.45
74 0.5
75 0.52
76 0.51
77 0.54
78 0.5
79 0.48
80 0.55
81 0.61
82 0.56
83 0.57
84 0.56
85 0.53
86 0.52
87 0.49