Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9ZAZ5

Protein Details
Accession A0A0C9ZAZ5    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
180-203GLVVKRGANSRPRHKRRPARRWRYBasic
NLS Segment(s)
PositionSequence
184-203KRGANSRPRHKRRPARRWRY
Subcellular Location(s) nucl 18, cyto_nucl 14.5, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR005103  AA9  
Gene Ontology GO:0005576  C:extracellular region  
GO:0008810  F:cellulase activity  
GO:0030248  F:cellulose binding  
GO:0030245  P:cellulose catabolic process  
Pfam View protein in Pfam  
PF03443  AA9  
CDD cd21175  LPMO_AA9  
Amino Acid Sequences MHYMTKCSGSCSSFDSTSAEWFKISELGLETSDTWYQANLVVEDPANVTIPSNIEPGEYLLRSEIISLQLAVSVGGAEFYPACIQLSIGGSGTGAPQSNEVCQFPGCYTDTEAGIYTPNIYNPPINYTFPGPPVAAFVNGSSDSDSNSGSGTENPAATTSPTPSTGSQTCKLVSSSNPAGLVVKRGANSRPRHKRRPARRWRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.23
4 0.29
5 0.3
6 0.26
7 0.21
8 0.21
9 0.21
10 0.19
11 0.18
12 0.13
13 0.13
14 0.14
15 0.14
16 0.15
17 0.15
18 0.16
19 0.16
20 0.14
21 0.12
22 0.11
23 0.1
24 0.12
25 0.13
26 0.11
27 0.11
28 0.11
29 0.11
30 0.12
31 0.12
32 0.1
33 0.09
34 0.09
35 0.08
36 0.08
37 0.09
38 0.1
39 0.1
40 0.1
41 0.09
42 0.09
43 0.11
44 0.13
45 0.12
46 0.11
47 0.1
48 0.11
49 0.11
50 0.11
51 0.1
52 0.08
53 0.08
54 0.08
55 0.07
56 0.07
57 0.07
58 0.07
59 0.05
60 0.04
61 0.03
62 0.04
63 0.03
64 0.03
65 0.03
66 0.04
67 0.04
68 0.04
69 0.05
70 0.04
71 0.05
72 0.06
73 0.07
74 0.07
75 0.07
76 0.07
77 0.06
78 0.07
79 0.07
80 0.06
81 0.05
82 0.05
83 0.06
84 0.06
85 0.07
86 0.09
87 0.09
88 0.09
89 0.09
90 0.09
91 0.08
92 0.1
93 0.1
94 0.09
95 0.11
96 0.11
97 0.11
98 0.11
99 0.11
100 0.08
101 0.08
102 0.07
103 0.08
104 0.07
105 0.07
106 0.08
107 0.09
108 0.1
109 0.09
110 0.14
111 0.16
112 0.16
113 0.17
114 0.19
115 0.2
116 0.2
117 0.21
118 0.16
119 0.14
120 0.15
121 0.14
122 0.12
123 0.11
124 0.1
125 0.11
126 0.11
127 0.11
128 0.1
129 0.1
130 0.1
131 0.11
132 0.11
133 0.08
134 0.08
135 0.08
136 0.08
137 0.09
138 0.11
139 0.11
140 0.11
141 0.11
142 0.12
143 0.12
144 0.13
145 0.14
146 0.13
147 0.14
148 0.15
149 0.18
150 0.18
151 0.23
152 0.26
153 0.3
154 0.31
155 0.31
156 0.3
157 0.3
158 0.3
159 0.27
160 0.24
161 0.27
162 0.28
163 0.27
164 0.27
165 0.26
166 0.27
167 0.25
168 0.27
169 0.22
170 0.21
171 0.2
172 0.23
173 0.29
174 0.35
175 0.44
176 0.51
177 0.6
178 0.66
179 0.75
180 0.83
181 0.88
182 0.91
183 0.93