Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9YH50

Protein Details
Accession A0A0C9YH50    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-30IRSETSKSRPCKAPRNKHDKERRAQHVRTBasic
NLS Segment(s)
PositionSequence
18-19KH
21-21K
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MIRSETSKSRPCKAPRNKHDKERRAQHVRTIYKPTRAITDRNGRPIWRVLGKSRSPRATCSERMRIGDPGECPVESRGYPSGGTPTYSRQTPRGSDTDKRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.8
3 0.86
4 0.86
5 0.87
6 0.9
7 0.89
8 0.88
9 0.87
10 0.86
11 0.85
12 0.79
13 0.76
14 0.75
15 0.71
16 0.65
17 0.65
18 0.58
19 0.56
20 0.57
21 0.49
22 0.47
23 0.44
24 0.42
25 0.4
26 0.47
27 0.43
28 0.46
29 0.47
30 0.39
31 0.39
32 0.38
33 0.34
34 0.28
35 0.27
36 0.25
37 0.31
38 0.35
39 0.4
40 0.43
41 0.46
42 0.43
43 0.44
44 0.47
45 0.45
46 0.47
47 0.47
48 0.49
49 0.46
50 0.47
51 0.46
52 0.42
53 0.38
54 0.34
55 0.28
56 0.23
57 0.22
58 0.19
59 0.18
60 0.17
61 0.18
62 0.15
63 0.17
64 0.16
65 0.16
66 0.17
67 0.16
68 0.2
69 0.18
70 0.2
71 0.19
72 0.23
73 0.25
74 0.29
75 0.31
76 0.32
77 0.37
78 0.39
79 0.43
80 0.46
81 0.48