Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9YUU2

Protein Details
Accession A0A0C9YUU2    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
28-56TPYRHQPQRYYPPPHKREKKPTAKLSWENHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 11
Family & Domain DBs
Amino Acid Sequences SPTTICRMPTSPPDDPTPSLNLLCLAQTPYRHQPQRYYPPPHKREKKPTAKLSWEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.43
3 0.41
4 0.36
5 0.31
6 0.26
7 0.23
8 0.19
9 0.15
10 0.14
11 0.12
12 0.1
13 0.1
14 0.11
15 0.15
16 0.21
17 0.29
18 0.33
19 0.34
20 0.38
21 0.46
22 0.56
23 0.6
24 0.63
25 0.65
26 0.72
27 0.78
28 0.83
29 0.83
30 0.83
31 0.85
32 0.87
33 0.89
34 0.88
35 0.91
36 0.89