Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9D260

Protein Details
Accession E9D260   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
150-175AELQQQGTTKKKKRKIKTSPWEGESGHydrophilic
NLS Segment(s)
PositionSequence
159-166KKKKRKIK
Subcellular Location(s) mito 18, nucl 8.5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007763  NDUFA12  
Gene Ontology GO:0016020  C:membrane  
GO:0032981  P:mitochondrial respiratory chain complex I assembly  
Pfam View protein in Pfam  
PF05071  NDUFA12  
Amino Acid Sequences MSVNSLWFKWKSLRLPWRRFFLVGQDLAGNTFWEFKDAANSSRLRRIVKYNPKTHYADVKVSPQWHQWLRHVRPEPPSIAEQQQELVRQEQIKYLAKLADERWASKPSYLDKPQEQQPGPAIESRTPAYHTGPKPTAEQAGVRSAIGSEAELQQQGTTKKKKRKIKTSPWEGESGAPGEKWQPEAWNPSAAKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.72
3 0.76
4 0.77
5 0.72
6 0.68
7 0.59
8 0.56
9 0.53
10 0.43
11 0.37
12 0.31
13 0.27
14 0.26
15 0.25
16 0.17
17 0.1
18 0.12
19 0.1
20 0.11
21 0.11
22 0.1
23 0.18
24 0.19
25 0.21
26 0.24
27 0.27
28 0.28
29 0.35
30 0.38
31 0.34
32 0.35
33 0.41
34 0.46
35 0.54
36 0.61
37 0.62
38 0.62
39 0.66
40 0.66
41 0.61
42 0.59
43 0.52
44 0.48
45 0.42
46 0.43
47 0.4
48 0.38
49 0.37
50 0.31
51 0.34
52 0.34
53 0.34
54 0.37
55 0.44
56 0.46
57 0.53
58 0.53
59 0.5
60 0.51
61 0.51
62 0.45
63 0.38
64 0.36
65 0.3
66 0.29
67 0.26
68 0.2
69 0.19
70 0.18
71 0.18
72 0.17
73 0.15
74 0.14
75 0.15
76 0.15
77 0.15
78 0.18
79 0.19
80 0.18
81 0.18
82 0.18
83 0.17
84 0.18
85 0.16
86 0.19
87 0.16
88 0.18
89 0.2
90 0.21
91 0.21
92 0.21
93 0.23
94 0.21
95 0.28
96 0.3
97 0.31
98 0.33
99 0.36
100 0.41
101 0.47
102 0.43
103 0.37
104 0.36
105 0.34
106 0.31
107 0.3
108 0.25
109 0.18
110 0.2
111 0.2
112 0.18
113 0.17
114 0.18
115 0.19
116 0.26
117 0.26
118 0.31
119 0.32
120 0.33
121 0.33
122 0.33
123 0.32
124 0.25
125 0.25
126 0.2
127 0.22
128 0.21
129 0.18
130 0.17
131 0.14
132 0.13
133 0.12
134 0.1
135 0.07
136 0.08
137 0.1
138 0.1
139 0.1
140 0.1
141 0.14
142 0.17
143 0.24
144 0.33
145 0.41
146 0.51
147 0.6
148 0.7
149 0.76
150 0.84
151 0.87
152 0.88
153 0.91
154 0.92
155 0.91
156 0.85
157 0.77
158 0.67
159 0.58
160 0.49
161 0.4
162 0.3
163 0.21
164 0.18
165 0.18
166 0.19
167 0.2
168 0.19
169 0.21
170 0.25
171 0.32
172 0.34
173 0.38