Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9Z495

Protein Details
Accession A0A0C9Z495   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
17-36YPPTPGRRGKAKNDMWRLIKHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 22, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006073  GTP-bd  
IPR027417  P-loop_NTPase  
IPR025662  Sigma_54_int_dom_ATP-bd_1  
Gene Ontology GO:0005525  F:GTP binding  
Pfam View protein in Pfam  
PF01926  MMR_HSR1  
PROSITE View protein in PROSITE  
PS00675  SIGMA54_INTERACT_1  
CDD cd00882  Ras_like_GTPase  
Amino Acid Sequences LIFEGYACVSTLEDEDYPPTPGRRGKAKNDMWRLIKKHANPLLSPGSSPKEVNVLLFGQTGVGKSSVVNLIAGRNVAQVSPDAEGCTMSSTEYRFVVGAHHFRIWDTIGLEEPMVEMNTYLNAIMKALQLIRRVAAAGGVNLLLFCMPGRRVTRTIQSNYRLFYEMLCEGKVPIGLVITYLEREKDMEDWWVRNSRPLYDYGIKSVGHACVTGLPDLQEKYALSRAAIYGLLTDCDRYGKYIMPRDGLLRRLVRNMEMFVMGGSLPKGEKLTQALMTRGGLKEDDARKLARCLEDAEREPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.15
4 0.18
5 0.2
6 0.21
7 0.24
8 0.28
9 0.33
10 0.4
11 0.47
12 0.53
13 0.61
14 0.69
15 0.74
16 0.78
17 0.81
18 0.78
19 0.79
20 0.74
21 0.72
22 0.7
23 0.64
24 0.65
25 0.63
26 0.59
27 0.51
28 0.53
29 0.52
30 0.45
31 0.41
32 0.35
33 0.34
34 0.32
35 0.31
36 0.25
37 0.23
38 0.23
39 0.23
40 0.21
41 0.17
42 0.16
43 0.16
44 0.15
45 0.11
46 0.11
47 0.11
48 0.09
49 0.09
50 0.08
51 0.07
52 0.1
53 0.11
54 0.11
55 0.11
56 0.1
57 0.11
58 0.12
59 0.12
60 0.1
61 0.09
62 0.09
63 0.08
64 0.08
65 0.08
66 0.09
67 0.1
68 0.1
69 0.09
70 0.09
71 0.09
72 0.09
73 0.09
74 0.08
75 0.08
76 0.09
77 0.09
78 0.11
79 0.11
80 0.11
81 0.1
82 0.1
83 0.12
84 0.15
85 0.18
86 0.18
87 0.19
88 0.19
89 0.19
90 0.2
91 0.18
92 0.15
93 0.12
94 0.1
95 0.1
96 0.1
97 0.1
98 0.08
99 0.07
100 0.06
101 0.06
102 0.05
103 0.04
104 0.04
105 0.04
106 0.05
107 0.04
108 0.05
109 0.04
110 0.05
111 0.06
112 0.06
113 0.06
114 0.08
115 0.11
116 0.12
117 0.12
118 0.12
119 0.12
120 0.12
121 0.11
122 0.11
123 0.08
124 0.06
125 0.06
126 0.06
127 0.05
128 0.05
129 0.05
130 0.03
131 0.03
132 0.03
133 0.04
134 0.04
135 0.09
136 0.11
137 0.14
138 0.17
139 0.19
140 0.27
141 0.32
142 0.36
143 0.37
144 0.41
145 0.4
146 0.38
147 0.38
148 0.33
149 0.26
150 0.22
151 0.19
152 0.16
153 0.15
154 0.14
155 0.12
156 0.1
157 0.1
158 0.1
159 0.07
160 0.05
161 0.05
162 0.04
163 0.05
164 0.05
165 0.05
166 0.06
167 0.06
168 0.06
169 0.06
170 0.07
171 0.07
172 0.08
173 0.08
174 0.13
175 0.15
176 0.16
177 0.19
178 0.24
179 0.23
180 0.27
181 0.28
182 0.25
183 0.24
184 0.25
185 0.29
186 0.3
187 0.31
188 0.28
189 0.3
190 0.27
191 0.26
192 0.26
193 0.21
194 0.15
195 0.14
196 0.12
197 0.12
198 0.13
199 0.13
200 0.11
201 0.11
202 0.13
203 0.13
204 0.13
205 0.12
206 0.11
207 0.13
208 0.17
209 0.16
210 0.14
211 0.14
212 0.14
213 0.14
214 0.14
215 0.11
216 0.09
217 0.09
218 0.1
219 0.09
220 0.1
221 0.09
222 0.1
223 0.11
224 0.11
225 0.12
226 0.16
227 0.23
228 0.31
229 0.34
230 0.34
231 0.35
232 0.38
233 0.41
234 0.39
235 0.39
236 0.35
237 0.35
238 0.38
239 0.39
240 0.36
241 0.35
242 0.33
243 0.28
244 0.24
245 0.21
246 0.16
247 0.15
248 0.11
249 0.1
250 0.08
251 0.08
252 0.07
253 0.08
254 0.11
255 0.11
256 0.14
257 0.17
258 0.21
259 0.26
260 0.28
261 0.29
262 0.29
263 0.29
264 0.3
265 0.27
266 0.25
267 0.19
268 0.19
269 0.26
270 0.28
271 0.32
272 0.31
273 0.33
274 0.34
275 0.38
276 0.41
277 0.36
278 0.33
279 0.33
280 0.37
281 0.43