Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9YPH2

Protein Details
Accession A0A0C9YPH2   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
114-146DVKKTKKLTSSELRKKKKERIARRKRGEEVFSDBasic
NLS Segment(s)
PositionSequence
116-140KKTKKLTSSELRKKKKERIARRKRG
Subcellular Location(s) mito 13.5, cyto_mito 9, nucl 5, cyto 3.5, extr 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR003439  ABC_transporter-like_ATP-bd  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005524  F:ATP binding  
Pfam View protein in Pfam  
PF00005  ABC_tran  
Amino Acid Sequences MRGLSGGQKVKIVLGAATWRRPHVICLDEPTNYLDRESLAALIGALKVFEGGVLIITHNKDFSESICTEVWAMRDGHLEASGHNWVEGQGSGPRIDKKDGEEEVQYDAMGNKIDVKKTKKLTSSELRKKKKERIARRKRGEEVFSDEDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.2
3 0.22
4 0.28
5 0.29
6 0.28
7 0.31
8 0.31
9 0.32
10 0.3
11 0.3
12 0.27
13 0.32
14 0.33
15 0.31
16 0.31
17 0.32
18 0.28
19 0.24
20 0.22
21 0.15
22 0.13
23 0.14
24 0.13
25 0.1
26 0.08
27 0.07
28 0.07
29 0.07
30 0.06
31 0.05
32 0.04
33 0.04
34 0.04
35 0.03
36 0.03
37 0.03
38 0.03
39 0.03
40 0.04
41 0.04
42 0.06
43 0.07
44 0.07
45 0.07
46 0.07
47 0.08
48 0.08
49 0.08
50 0.12
51 0.12
52 0.15
53 0.14
54 0.15
55 0.14
56 0.15
57 0.14
58 0.11
59 0.11
60 0.08
61 0.09
62 0.1
63 0.1
64 0.09
65 0.09
66 0.07
67 0.09
68 0.09
69 0.08
70 0.08
71 0.07
72 0.07
73 0.07
74 0.07
75 0.07
76 0.07
77 0.09
78 0.1
79 0.12
80 0.15
81 0.16
82 0.18
83 0.18
84 0.19
85 0.25
86 0.25
87 0.25
88 0.24
89 0.23
90 0.23
91 0.22
92 0.19
93 0.13
94 0.11
95 0.1
96 0.09
97 0.08
98 0.12
99 0.14
100 0.19
101 0.25
102 0.31
103 0.38
104 0.45
105 0.52
106 0.52
107 0.54
108 0.59
109 0.63
110 0.68
111 0.71
112 0.75
113 0.78
114 0.81
115 0.85
116 0.86
117 0.86
118 0.86
119 0.86
120 0.87
121 0.89
122 0.91
123 0.93
124 0.92
125 0.9
126 0.87
127 0.8
128 0.74
129 0.71