Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9YJS9

Protein Details
Accession A0A0C9YJS9   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
41-68PAKPKQPKSSQGKSKRPPAMNKNAHKYTHydrophilic
NLS Segment(s)
PositionSequence
42-65AKPKQPKSSQGKSKRPPAMNKNAH
Subcellular Location(s) nucl 15, cyto_nucl 12, cyto 7, mito 3
Family & Domain DBs
Amino Acid Sequences MSSEDSSEDWYIDLEEPVSLNLAEFVPCKATVNCCTRHVAPAKPKQPKSSQGKSKRPPAMNKNAHKYTKHVSTTAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.08
5 0.09
6 0.07
7 0.06
8 0.06
9 0.06
10 0.07
11 0.07
12 0.08
13 0.08
14 0.09
15 0.11
16 0.11
17 0.14
18 0.2
19 0.24
20 0.27
21 0.27
22 0.3
23 0.29
24 0.34
25 0.33
26 0.33
27 0.37
28 0.43
29 0.5
30 0.55
31 0.58
32 0.58
33 0.61
34 0.64
35 0.64
36 0.65
37 0.67
38 0.69
39 0.77
40 0.78
41 0.82
42 0.82
43 0.8
44 0.8
45 0.79
46 0.79
47 0.79
48 0.81
49 0.8
50 0.8
51 0.78
52 0.71
53 0.67
54 0.63
55 0.63
56 0.57
57 0.52