Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9YZT3

Protein Details
Accession A0A0C9YZT3    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MMRSVKPSRGARRRARSCSLRNRERTFGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 5, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MMRSVKPSRGARRRARSCSLRNRERTFGDPESMLGSYIGTLVQRDCSEGGACYHGWLLYLRKNVMRGSLHWNSMSYPTAILLSLSTVRSLVFLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.83
4 0.83
5 0.84
6 0.84
7 0.83
8 0.82
9 0.8
10 0.76
11 0.7
12 0.65
13 0.6
14 0.52
15 0.45
16 0.35
17 0.3
18 0.27
19 0.23
20 0.19
21 0.12
22 0.09
23 0.07
24 0.07
25 0.06
26 0.04
27 0.05
28 0.04
29 0.06
30 0.06
31 0.07
32 0.07
33 0.08
34 0.08
35 0.08
36 0.09
37 0.09
38 0.08
39 0.08
40 0.08
41 0.07
42 0.07
43 0.08
44 0.1
45 0.13
46 0.17
47 0.18
48 0.19
49 0.22
50 0.22
51 0.26
52 0.25
53 0.23
54 0.28
55 0.31
56 0.32
57 0.3
58 0.3
59 0.26
60 0.27
61 0.26
62 0.18
63 0.14
64 0.13
65 0.12
66 0.12
67 0.11
68 0.08
69 0.09
70 0.11
71 0.11
72 0.11
73 0.1
74 0.1