Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9YMR7

Protein Details
Accession A0A0C9YMR7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MAKNTKKKPNTKTIAKLVVFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MAKNTKKKPNTKTIAKLVVFLRRLWLEGSVKIKWGRGSVHLEGARAGGIGAPDEGGAGED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.71
3 0.66
4 0.58
5 0.56
6 0.48
7 0.39
8 0.34
9 0.25
10 0.25
11 0.22
12 0.22
13 0.16
14 0.18
15 0.22
16 0.18
17 0.21
18 0.21
19 0.22
20 0.19
21 0.2
22 0.18
23 0.19
24 0.25
25 0.23
26 0.3
27 0.3
28 0.29
29 0.27
30 0.26
31 0.21
32 0.14
33 0.13
34 0.06
35 0.06
36 0.06
37 0.06
38 0.06
39 0.05
40 0.05