Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9ZKN7

Protein Details
Accession A0A0C9ZKN7   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
67-93KQPVSPQTSPTKKPKKQKTAGKSPVSPHydrophilic
NLS Segment(s)
PositionSequence
77-88TKKPKKQKTAGK
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MGIGTGSRRAAARGTLKTKLPIETIRSDSPLQGSENGNFSDDNSGAKVKAKSKGKNTDDDEFNLKRKQPVSPQTSPTKKPKKQKTAGKSPVSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.39
3 0.41
4 0.45
5 0.46
6 0.41
7 0.38
8 0.34
9 0.34
10 0.35
11 0.38
12 0.35
13 0.36
14 0.34
15 0.31
16 0.28
17 0.24
18 0.2
19 0.18
20 0.18
21 0.16
22 0.18
23 0.17
24 0.16
25 0.14
26 0.14
27 0.13
28 0.11
29 0.1
30 0.09
31 0.09
32 0.09
33 0.12
34 0.15
35 0.15
36 0.23
37 0.3
38 0.35
39 0.43
40 0.53
41 0.53
42 0.59
43 0.6
44 0.59
45 0.54
46 0.51
47 0.48
48 0.4
49 0.41
50 0.36
51 0.34
52 0.31
53 0.31
54 0.33
55 0.37
56 0.44
57 0.49
58 0.51
59 0.56
60 0.62
61 0.68
62 0.69
63 0.71
64 0.72
65 0.72
66 0.76
67 0.81
68 0.82
69 0.85
70 0.89
71 0.88
72 0.89
73 0.91