Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9DD14

Protein Details
Accession E9DD14   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKRHRSRKKRGPVRPLTWSPGBasic
70-92FETACRERKGRSRVEKPKPSLLEHydrophilic
NLS Segment(s)
PositionSequence
2-12KRHRSRKKRGP
Subcellular Location(s) mito 13, plas 4, E.R. 3, golg 3, cyto 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKRHRSRKKRGPVRPLTWSPGLVYQHCAISAFQRRPALLFFFSFFSFFFLAFCGWLSSSSGGADYRSSGFETACRERKGRSRVEKPKPSLLESN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.82
3 0.76
4 0.68
5 0.58
6 0.49
7 0.44
8 0.4
9 0.31
10 0.29
11 0.24
12 0.22
13 0.21
14 0.2
15 0.14
16 0.18
17 0.26
18 0.24
19 0.28
20 0.29
21 0.29
22 0.29
23 0.3
24 0.26
25 0.19
26 0.18
27 0.15
28 0.15
29 0.15
30 0.14
31 0.13
32 0.12
33 0.11
34 0.1
35 0.08
36 0.07
37 0.07
38 0.07
39 0.07
40 0.05
41 0.05
42 0.06
43 0.07
44 0.07
45 0.07
46 0.07
47 0.08
48 0.08
49 0.08
50 0.08
51 0.08
52 0.08
53 0.09
54 0.1
55 0.1
56 0.1
57 0.12
58 0.18
59 0.25
60 0.31
61 0.33
62 0.34
63 0.38
64 0.48
65 0.53
66 0.57
67 0.6
68 0.64
69 0.72
70 0.82
71 0.87
72 0.84
73 0.86
74 0.8