Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9ZH36

Protein Details
Accession A0A0C9ZH36    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-46MAIKIPIVKKRTKPFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
8-52VKKRTKPFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGQLPMPK
Subcellular Location(s) mito 16.5, mito_nucl 13.5, nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAIKIPIVKKRTKPFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGQLPMPKIGYGSNKKTRHLMPNGLKKFLVSNVKEVDILLMHNKSYAAEIAHNVSSRNRAVIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.87
3 0.9
4 0.91
5 0.9
6 0.89
7 0.86
8 0.85
9 0.81
10 0.73
11 0.64
12 0.58
13 0.54
14 0.53
15 0.55
16 0.55
17 0.5
18 0.48
19 0.49
20 0.53
21 0.57
22 0.58
23 0.58
24 0.6
25 0.68
26 0.77
27 0.81
28 0.75
29 0.72
30 0.69
31 0.65
32 0.65
33 0.61
34 0.61
35 0.61
36 0.62
37 0.56
38 0.49
39 0.44
40 0.35
41 0.35
42 0.3
43 0.32
44 0.38
45 0.39
46 0.4
47 0.44
48 0.46
49 0.47
50 0.47
51 0.49
52 0.48
53 0.56
54 0.58
55 0.56
56 0.51
57 0.43
58 0.39
59 0.36
60 0.35
61 0.26
62 0.28
63 0.29
64 0.3
65 0.29
66 0.28
67 0.23
68 0.15
69 0.15
70 0.13
71 0.12
72 0.11
73 0.12
74 0.12
75 0.11
76 0.12
77 0.13
78 0.1
79 0.11
80 0.13
81 0.16
82 0.19
83 0.19
84 0.19
85 0.2
86 0.24
87 0.23