Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9YYQ4

Protein Details
Accession A0A0C9YYQ4    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-23GLLTIIRKSRRKEKEMRILFLGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, mito 11, cyto_nucl 8.333, cyto_pero 7.166, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR045873  Arl2  
IPR044612  ARL2/3  
IPR027417  P-loop_NTPase  
IPR005225  Small_GTP-bd_dom  
IPR006689  Small_GTPase_ARF/SAR  
Gene Ontology GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
Pfam View protein in Pfam  
PF00025  Arf  
PROSITE View protein in PROSITE  
PS51417  ARF  
CDD cd04154  Arl2  
Amino Acid Sequences MGLLTIIRKSRRKEKEMRILFLGLDNAGKTTILKRINGEDISSISPTLGFNIKTFVHRSYTLNIWDVGGQRTLRPYWRNYFEQTDAIVWVVDSSDRVRIQDCKEELHNLLQEDRLTGASLLVFANKQDIHGSMTDKEIHDLLGLSGIKSHHWKISPCSAVTGYNLIAGLDWVVGDVARRLYYSPVTSNAGENSLDAVSPPQARSVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.81
3 0.83
4 0.81
5 0.74
6 0.65
7 0.56
8 0.48
9 0.38
10 0.27
11 0.2
12 0.15
13 0.11
14 0.11
15 0.1
16 0.09
17 0.1
18 0.17
19 0.19
20 0.21
21 0.23
22 0.27
23 0.33
24 0.33
25 0.31
26 0.26
27 0.24
28 0.25
29 0.23
30 0.18
31 0.12
32 0.12
33 0.11
34 0.12
35 0.12
36 0.11
37 0.11
38 0.14
39 0.15
40 0.17
41 0.2
42 0.2
43 0.21
44 0.22
45 0.24
46 0.24
47 0.27
48 0.26
49 0.25
50 0.23
51 0.2
52 0.2
53 0.19
54 0.17
55 0.16
56 0.14
57 0.13
58 0.16
59 0.16
60 0.2
61 0.22
62 0.25
63 0.3
64 0.35
65 0.38
66 0.39
67 0.42
68 0.39
69 0.37
70 0.33
71 0.26
72 0.2
73 0.17
74 0.13
75 0.08
76 0.06
77 0.05
78 0.04
79 0.04
80 0.05
81 0.08
82 0.08
83 0.09
84 0.11
85 0.14
86 0.17
87 0.23
88 0.23
89 0.21
90 0.22
91 0.24
92 0.24
93 0.23
94 0.22
95 0.16
96 0.16
97 0.15
98 0.14
99 0.12
100 0.12
101 0.09
102 0.07
103 0.07
104 0.06
105 0.05
106 0.06
107 0.05
108 0.05
109 0.05
110 0.05
111 0.07
112 0.07
113 0.08
114 0.08
115 0.09
116 0.1
117 0.11
118 0.14
119 0.12
120 0.14
121 0.16
122 0.15
123 0.15
124 0.14
125 0.12
126 0.11
127 0.1
128 0.08
129 0.1
130 0.1
131 0.09
132 0.11
133 0.11
134 0.13
135 0.16
136 0.18
137 0.18
138 0.21
139 0.24
140 0.27
141 0.36
142 0.38
143 0.35
144 0.37
145 0.34
146 0.31
147 0.3
148 0.27
149 0.18
150 0.15
151 0.15
152 0.11
153 0.1
154 0.09
155 0.07
156 0.05
157 0.04
158 0.04
159 0.04
160 0.04
161 0.04
162 0.06
163 0.07
164 0.08
165 0.08
166 0.09
167 0.13
168 0.16
169 0.19
170 0.21
171 0.23
172 0.27
173 0.27
174 0.29
175 0.27
176 0.25
177 0.22
178 0.19
179 0.18
180 0.14
181 0.13
182 0.11
183 0.11
184 0.13
185 0.16
186 0.17