Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9XQ14

Protein Details
Accession A0A0C9XQ14    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPIEKRKPCNKPLPYNRKPREPKVKDAPATHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 4
Family & Domain DBs
Amino Acid Sequences MPIEKRKPCNKPLPYNRKPREPKVKDAPATSAQPIIHASCENLTLNDLFTVFAYIDLHPTLLQASVVDHFKTLPSGALIFTQSTLPHKLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.89
3 0.87
4 0.87
5 0.85
6 0.84
7 0.84
8 0.79
9 0.79
10 0.78
11 0.81
12 0.74
13 0.67
14 0.62
15 0.55
16 0.52
17 0.43
18 0.36
19 0.26
20 0.23
21 0.22
22 0.18
23 0.14
24 0.12
25 0.11
26 0.08
27 0.1
28 0.09
29 0.08
30 0.09
31 0.08
32 0.08
33 0.07
34 0.07
35 0.05
36 0.05
37 0.06
38 0.05
39 0.05
40 0.06
41 0.06
42 0.07
43 0.07
44 0.08
45 0.07
46 0.07
47 0.07
48 0.06
49 0.06
50 0.05
51 0.06
52 0.08
53 0.1
54 0.1
55 0.1
56 0.1
57 0.1
58 0.11
59 0.11
60 0.09
61 0.09
62 0.1
63 0.1
64 0.12
65 0.12
66 0.12
67 0.12
68 0.13
69 0.13
70 0.16