Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9ZAL6

Protein Details
Accession A0A0C9ZAL6   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
56-76TYDALRPRRRRETDPRIRMKHBasic
NLS Segment(s)
PositionSequence
62-79PRRRRETDPRIRMKHGER
Subcellular Location(s) mito 14, nucl 11
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MALATISQLRGPFEPRSRGEMIVFSQFSGRPPGDYWNFFGGALAVALGYSTVLPNTYDALRPRRRRETDPRIRMKHGERPFEKLRSLPSQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.37
3 0.43
4 0.43
5 0.42
6 0.39
7 0.35
8 0.31
9 0.3
10 0.27
11 0.21
12 0.2
13 0.19
14 0.19
15 0.21
16 0.19
17 0.14
18 0.15
19 0.21
20 0.23
21 0.24
22 0.26
23 0.23
24 0.24
25 0.22
26 0.21
27 0.15
28 0.11
29 0.09
30 0.06
31 0.03
32 0.02
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.03
40 0.04
41 0.04
42 0.06
43 0.07
44 0.1
45 0.14
46 0.24
47 0.33
48 0.41
49 0.48
50 0.57
51 0.62
52 0.67
53 0.74
54 0.77
55 0.78
56 0.81
57 0.84
58 0.79
59 0.78
60 0.77
61 0.72
62 0.71
63 0.68
64 0.68
65 0.6
66 0.62
67 0.65
68 0.62
69 0.58
70 0.51
71 0.5