Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9ZWX3

Protein Details
Accession A0A0C9ZWX3    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
135-168YEHRVVDQQRKNKNRNEKNIKECKDREKRKERMVBasic
NLS Segment(s)
PositionSequence
158-164KDREKRK
Subcellular Location(s) nucl 10, mito 6, extr 6, cyto 5
Family & Domain DBs
Amino Acid Sequences MSVALSPHPLTSLSFCLFLSLSCVRGERDIHRVYLIKSVLDTSSRHLSFAKRYLGSPRRFANYPRLYLASLFLVENDTPPLLVSTSAHTKNCSFRCDDDPHAHGPGSPSAARELLTASVCPPSSQLNPSSSIYIYEHRVVDQQRKNKNRNEKNIKECKDREKRKERMV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.19
4 0.19
5 0.17
6 0.19
7 0.15
8 0.15
9 0.15
10 0.17
11 0.16
12 0.19
13 0.23
14 0.21
15 0.28
16 0.29
17 0.29
18 0.31
19 0.32
20 0.3
21 0.33
22 0.3
23 0.22
24 0.2
25 0.21
26 0.19
27 0.18
28 0.18
29 0.16
30 0.23
31 0.23
32 0.24
33 0.24
34 0.26
35 0.29
36 0.34
37 0.36
38 0.28
39 0.3
40 0.39
41 0.46
42 0.47
43 0.47
44 0.44
45 0.43
46 0.43
47 0.45
48 0.45
49 0.42
50 0.41
51 0.37
52 0.36
53 0.31
54 0.3
55 0.29
56 0.19
57 0.14
58 0.11
59 0.09
60 0.08
61 0.08
62 0.08
63 0.07
64 0.06
65 0.06
66 0.06
67 0.06
68 0.05
69 0.05
70 0.05
71 0.07
72 0.12
73 0.14
74 0.15
75 0.16
76 0.18
77 0.25
78 0.27
79 0.27
80 0.24
81 0.25
82 0.31
83 0.34
84 0.36
85 0.34
86 0.34
87 0.34
88 0.33
89 0.29
90 0.24
91 0.21
92 0.18
93 0.17
94 0.15
95 0.13
96 0.13
97 0.14
98 0.13
99 0.12
100 0.12
101 0.1
102 0.1
103 0.1
104 0.09
105 0.12
106 0.11
107 0.11
108 0.12
109 0.14
110 0.16
111 0.18
112 0.21
113 0.2
114 0.24
115 0.25
116 0.26
117 0.22
118 0.22
119 0.21
120 0.21
121 0.22
122 0.22
123 0.22
124 0.2
125 0.25
126 0.27
127 0.35
128 0.4
129 0.45
130 0.52
131 0.62
132 0.68
133 0.72
134 0.8
135 0.8
136 0.83
137 0.86
138 0.85
139 0.87
140 0.9
141 0.88
142 0.87
143 0.83
144 0.83
145 0.83
146 0.84
147 0.84
148 0.84