Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9ZSK9

Protein Details
Accession A0A0C9ZSK9    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
199-231YLPHRSSPDDVRKPRRRRSRDRSRERSRECSYABasic
NLS Segment(s)
PositionSequence
210-224RKPRRRRSRDRSRER
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MYSSHPPHTPRSILKQQHSPVPVGCRSPDRPPAVHFPPSPALTRVYAAHPSSAYDRSPIVVSPNTCALPERGCPGRTYTLEDECAARSAPSKRRPSNGNHFHPRAVSNPISTSPTRSIGDDHTRNPPRTSPFTPPPLIPDLSSESDESDSFVTPFDTPNTSLTPAPSISKPRIRTDAMMPTSPYCPAQPSFPDDYPSPYLPHRSSPDDVRKPRRRRSRDRSRERSRECSYASDETSGDGSYKSFSPPSSYTLREMDDGCLGGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.7
3 0.68
4 0.69
5 0.65
6 0.58
7 0.52
8 0.5
9 0.47
10 0.4
11 0.4
12 0.39
13 0.4
14 0.45
15 0.5
16 0.48
17 0.47
18 0.49
19 0.54
20 0.53
21 0.56
22 0.49
23 0.46
24 0.46
25 0.46
26 0.44
27 0.37
28 0.34
29 0.28
30 0.29
31 0.25
32 0.23
33 0.26
34 0.24
35 0.25
36 0.22
37 0.22
38 0.24
39 0.25
40 0.22
41 0.18
42 0.18
43 0.17
44 0.17
45 0.16
46 0.16
47 0.18
48 0.18
49 0.19
50 0.22
51 0.21
52 0.2
53 0.21
54 0.18
55 0.17
56 0.18
57 0.2
58 0.21
59 0.22
60 0.22
61 0.25
62 0.3
63 0.28
64 0.33
65 0.33
66 0.31
67 0.32
68 0.31
69 0.28
70 0.23
71 0.22
72 0.16
73 0.12
74 0.13
75 0.19
76 0.27
77 0.35
78 0.44
79 0.47
80 0.52
81 0.57
82 0.61
83 0.65
84 0.67
85 0.67
86 0.66
87 0.64
88 0.6
89 0.57
90 0.5
91 0.41
92 0.37
93 0.28
94 0.21
95 0.2
96 0.2
97 0.22
98 0.21
99 0.22
100 0.18
101 0.21
102 0.2
103 0.19
104 0.2
105 0.21
106 0.29
107 0.28
108 0.28
109 0.34
110 0.39
111 0.4
112 0.39
113 0.38
114 0.35
115 0.39
116 0.4
117 0.38
118 0.38
119 0.42
120 0.42
121 0.38
122 0.36
123 0.33
124 0.3
125 0.23
126 0.2
127 0.18
128 0.18
129 0.19
130 0.16
131 0.14
132 0.14
133 0.14
134 0.13
135 0.09
136 0.08
137 0.07
138 0.07
139 0.07
140 0.07
141 0.08
142 0.09
143 0.09
144 0.1
145 0.12
146 0.13
147 0.14
148 0.14
149 0.14
150 0.15
151 0.14
152 0.15
153 0.16
154 0.19
155 0.23
156 0.29
157 0.32
158 0.35
159 0.39
160 0.39
161 0.39
162 0.4
163 0.44
164 0.4
165 0.38
166 0.34
167 0.31
168 0.3
169 0.28
170 0.24
171 0.15
172 0.15
173 0.14
174 0.17
175 0.18
176 0.23
177 0.28
178 0.28
179 0.31
180 0.28
181 0.33
182 0.33
183 0.32
184 0.29
185 0.24
186 0.3
187 0.28
188 0.34
189 0.34
190 0.35
191 0.37
192 0.44
193 0.53
194 0.56
195 0.64
196 0.69
197 0.75
198 0.79
199 0.86
200 0.88
201 0.88
202 0.89
203 0.9
204 0.91
205 0.92
206 0.94
207 0.94
208 0.94
209 0.95
210 0.91
211 0.9
212 0.84
213 0.79
214 0.7
215 0.65
216 0.59
217 0.54
218 0.48
219 0.41
220 0.35
221 0.29
222 0.27
223 0.22
224 0.17
225 0.12
226 0.11
227 0.11
228 0.12
229 0.13
230 0.14
231 0.15
232 0.21
233 0.22
234 0.27
235 0.31
236 0.32
237 0.34
238 0.35
239 0.37
240 0.33
241 0.33
242 0.3
243 0.27