Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9Z6U8

Protein Details
Accession A0A0C9Z6U8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
69-94NNRSKWKTGQSIKERKARRRNKSVKSHydrophilic
NLS Segment(s)
PositionSequence
72-94SKWKTGQSIKERKARRRNKSVKS
Subcellular Location(s) mito 23.5, mito_nucl 14
Family & Domain DBs
Amino Acid Sequences MALTRKKVSTKTSMRRTYSLELGLMYPLCAAEESSVGPDMHGELPRRIVGISAEYGGRLPDAGIGPAANNRSKWKTGQSIKERKARRRNKSVKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.7
3 0.7
4 0.65
5 0.58
6 0.49
7 0.39
8 0.31
9 0.26
10 0.24
11 0.18
12 0.13
13 0.09
14 0.07
15 0.07
16 0.06
17 0.06
18 0.05
19 0.05
20 0.06
21 0.06
22 0.08
23 0.08
24 0.08
25 0.08
26 0.09
27 0.1
28 0.13
29 0.14
30 0.12
31 0.14
32 0.14
33 0.14
34 0.12
35 0.11
36 0.08
37 0.08
38 0.08
39 0.07
40 0.07
41 0.07
42 0.07
43 0.07
44 0.06
45 0.05
46 0.04
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.07
53 0.1
54 0.13
55 0.13
56 0.14
57 0.19
58 0.24
59 0.26
60 0.29
61 0.33
62 0.41
63 0.47
64 0.56
65 0.62
66 0.68
67 0.73
68 0.79
69 0.81
70 0.82
71 0.84
72 0.84
73 0.84
74 0.85