Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9Y796

Protein Details
Accession A0A0C9Y796    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
46-65PKTAKACKERWQRMKKMFNVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, pero 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR024752  Myb/SANT-like_dom  
IPR001005  SANT/Myb  
Pfam View protein in Pfam  
PF12776  Myb_DNA-bind_3  
PROSITE View protein in PROSITE  
PS50090  MYB_LIKE  
Amino Acid Sequences WTDAESNMLLDIISAHKASAGDGLNFKMTFWNTATAQLPRPTKGAPKTAKACKERWQRMKKMFNVVDRIANASGFTYLHESGASIGLENEGVWTDFVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.09
4 0.09
5 0.1
6 0.14
7 0.14
8 0.14
9 0.15
10 0.16
11 0.18
12 0.18
13 0.17
14 0.16
15 0.15
16 0.16
17 0.15
18 0.18
19 0.16
20 0.19
21 0.21
22 0.19
23 0.22
24 0.26
25 0.26
26 0.24
27 0.25
28 0.23
29 0.27
30 0.29
31 0.35
32 0.32
33 0.37
34 0.43
35 0.47
36 0.54
37 0.52
38 0.51
39 0.51
40 0.59
41 0.62
42 0.66
43 0.69
44 0.69
45 0.76
46 0.81
47 0.76
48 0.76
49 0.71
50 0.66
51 0.63
52 0.55
53 0.49
54 0.41
55 0.39
56 0.29
57 0.24
58 0.19
59 0.13
60 0.13
61 0.09
62 0.1
63 0.11
64 0.11
65 0.11
66 0.11
67 0.1
68 0.11
69 0.13
70 0.12
71 0.08
72 0.08
73 0.08
74 0.08
75 0.08
76 0.07
77 0.06
78 0.07