Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3D5D2

Protein Details
Accession A0A0C3D5D2    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
19-49CCPLSILPSGRKKKKKKKKPLIHPRPLKPTTBasic
NLS Segment(s)
PositionSequence
28-45GRKKKKKKKKPLIHPRPL
Subcellular Location(s) nucl 9.5, cyto_nucl 8.5, cyto 6.5, mito 4, pero 2, plas 1, extr 1, E.R. 1, golg 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MSPIDSPWLLEPVIVALQCCPLSILPSGRKKKKKKKKPLIHPRPLKPTTMYAWKMLKAVHPEELSPSKELQRTRERERGVQTRRSEGYFVPLKGGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.09
4 0.12
5 0.12
6 0.12
7 0.11
8 0.09
9 0.11
10 0.13
11 0.19
12 0.24
13 0.34
14 0.44
15 0.52
16 0.62
17 0.71
18 0.8
19 0.85
20 0.89
21 0.9
22 0.92
23 0.93
24 0.95
25 0.96
26 0.96
27 0.95
28 0.93
29 0.88
30 0.87
31 0.77
32 0.67
33 0.58
34 0.49
35 0.42
36 0.4
37 0.35
38 0.29
39 0.3
40 0.28
41 0.28
42 0.25
43 0.26
44 0.22
45 0.22
46 0.23
47 0.21
48 0.21
49 0.24
50 0.28
51 0.26
52 0.23
53 0.23
54 0.22
55 0.26
56 0.28
57 0.31
58 0.38
59 0.43
60 0.5
61 0.56
62 0.56
63 0.58
64 0.65
65 0.67
66 0.64
67 0.65
68 0.61
69 0.61
70 0.6
71 0.56
72 0.5
73 0.4
74 0.41
75 0.4
76 0.36