Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3ECU6

Protein Details
Accession A0A0C3ECU6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
95-120GEKEKERTAVRKRKRVDEVPPRRTAPBasic
NLS Segment(s)
PositionSequence
86-117KVKAVAAGRGEKEKERTAVRKRKRVDEVPPRR
Subcellular Location(s) mito 11cyto 11cyto_mito 11
Family & Domain DBs
Amino Acid Sequences MAVDVVLVLKFQAKFSATHNLMSTEEEPSQRELLLQLGIREITARMKGLLRIGWEERHNKECLIDYVIDHAPSETVEFLCDAGREKVKAVAAGRGEKEKERTAVRKRKRVDEVPPRRTAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.3
4 0.27
5 0.29
6 0.3
7 0.28
8 0.28
9 0.3
10 0.28
11 0.2
12 0.21
13 0.2
14 0.2
15 0.2
16 0.2
17 0.17
18 0.16
19 0.13
20 0.12
21 0.13
22 0.13
23 0.1
24 0.1
25 0.1
26 0.1
27 0.1
28 0.09
29 0.09
30 0.09
31 0.09
32 0.09
33 0.1
34 0.12
35 0.13
36 0.13
37 0.12
38 0.14
39 0.16
40 0.18
41 0.21
42 0.25
43 0.26
44 0.28
45 0.28
46 0.25
47 0.24
48 0.22
49 0.19
50 0.17
51 0.14
52 0.11
53 0.14
54 0.15
55 0.14
56 0.12
57 0.11
58 0.09
59 0.08
60 0.09
61 0.06
62 0.05
63 0.05
64 0.05
65 0.06
66 0.06
67 0.07
68 0.08
69 0.11
70 0.13
71 0.13
72 0.14
73 0.17
74 0.17
75 0.21
76 0.19
77 0.21
78 0.23
79 0.27
80 0.28
81 0.29
82 0.31
83 0.31
84 0.35
85 0.34
86 0.35
87 0.38
88 0.46
89 0.52
90 0.61
91 0.67
92 0.72
93 0.74
94 0.79
95 0.81
96 0.8
97 0.8
98 0.8
99 0.82
100 0.81