Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9DIX8

Protein Details
Accession E9DIX8   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
38-65LCIEARPFPKKRQKKKEEKEQDKNSTSHHydrophilic
NLS Segment(s)
PositionSequence
45-56FPKKRQKKKEEK
Subcellular Location(s) mito 11, nucl 9.5, cyto_nucl 7, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MADERRFQRRPGSPANSRSAYWCPIVIRRVTIMLVSVLCIEARPFPKKRQKKKEEKEQDKNSTSHRLPGQATGRRGSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.71
3 0.64
4 0.56
5 0.53
6 0.46
7 0.4
8 0.33
9 0.28
10 0.23
11 0.25
12 0.28
13 0.25
14 0.22
15 0.2
16 0.2
17 0.18
18 0.16
19 0.12
20 0.09
21 0.08
22 0.07
23 0.07
24 0.06
25 0.05
26 0.05
27 0.05
28 0.08
29 0.11
30 0.17
31 0.2
32 0.29
33 0.4
34 0.51
35 0.62
36 0.7
37 0.77
38 0.83
39 0.9
40 0.92
41 0.93
42 0.94
43 0.93
44 0.92
45 0.91
46 0.84
47 0.76
48 0.69
49 0.67
50 0.57
51 0.54
52 0.46
53 0.42
54 0.39
55 0.45
56 0.49
57 0.47
58 0.5