Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3E705

Protein Details
Accession A0A0C3E705    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
4-23GSHIGRKSKHRDIRSPFRPEBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12, nucl 11.5, cyto 7.5, mito 7
Family & Domain DBs
Amino Acid Sequences MDVGSHIGRKSKHRDIRSPFRPEILFSDKSLLRGIEKVTLCTSQRMENLVQYGLPQGDSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.71
3 0.79
4 0.8
5 0.79
6 0.7
7 0.65
8 0.58
9 0.49
10 0.46
11 0.42
12 0.34
13 0.26
14 0.3
15 0.26
16 0.26
17 0.25
18 0.19
19 0.14
20 0.13
21 0.14
22 0.16
23 0.16
24 0.17
25 0.18
26 0.21
27 0.21
28 0.23
29 0.24
30 0.22
31 0.23
32 0.25
33 0.24
34 0.24
35 0.25
36 0.22
37 0.21
38 0.17
39 0.18
40 0.15