Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2ZLF7

Protein Details
Accession A0A0C2ZLF7    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
110-137FKEGAKKVKTPRSPKKDKKKDELKEEPABasic
NLS Segment(s)
PositionSequence
111-131KEGAKKVKTPRSPKKDKKKDE
207-226PKEAKVEEKKRAAKVGRRIS
Subcellular Location(s) cyto 12.5, cyto_nucl 11.833, nucl 10, mito_nucl 7.333
Family & Domain DBs
Amino Acid Sequences MSTEPTVAAPVEEVKAVEPVPEPAAVTEPVPEASAAPEQVPATTEAPKEDEPKPAEPTSEASGEAPAEPAAEGAAAEPAKEEAKVEAAAEAKKDDRPKSPSILTKLLSSFKEGAKKVKTPRSPKKDKKKDELKEEPAPAAPATEEAPKDEPAPEPKEEPAAAEAPKPDETTAEPVKETENAPAEAPPAEPAAEPAPEAVAEPAPEPPKEAKVEEKKRAAKVGRRISARVGDFFKVKPKNEVSTPAKVDENPPMIDEPAPLAPLEVPAAEAAAAPAPTEETPAAAEPAPAATPVIAAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.13
4 0.13
5 0.12
6 0.13
7 0.14
8 0.15
9 0.14
10 0.13
11 0.16
12 0.15
13 0.14
14 0.13
15 0.13
16 0.13
17 0.13
18 0.12
19 0.1
20 0.11
21 0.14
22 0.13
23 0.12
24 0.14
25 0.13
26 0.13
27 0.14
28 0.15
29 0.14
30 0.18
31 0.18
32 0.17
33 0.22
34 0.24
35 0.27
36 0.26
37 0.32
38 0.33
39 0.36
40 0.4
41 0.37
42 0.36
43 0.32
44 0.34
45 0.29
46 0.26
47 0.22
48 0.17
49 0.17
50 0.16
51 0.15
52 0.12
53 0.08
54 0.08
55 0.07
56 0.06
57 0.05
58 0.05
59 0.04
60 0.04
61 0.07
62 0.07
63 0.07
64 0.07
65 0.08
66 0.09
67 0.09
68 0.09
69 0.07
70 0.09
71 0.09
72 0.09
73 0.1
74 0.12
75 0.12
76 0.12
77 0.13
78 0.13
79 0.17
80 0.22
81 0.24
82 0.28
83 0.33
84 0.36
85 0.4
86 0.44
87 0.47
88 0.46
89 0.48
90 0.42
91 0.39
92 0.38
93 0.37
94 0.32
95 0.29
96 0.26
97 0.23
98 0.3
99 0.28
100 0.32
101 0.32
102 0.38
103 0.42
104 0.49
105 0.55
106 0.58
107 0.68
108 0.72
109 0.79
110 0.83
111 0.87
112 0.89
113 0.88
114 0.88
115 0.88
116 0.85
117 0.84
118 0.83
119 0.79
120 0.74
121 0.67
122 0.57
123 0.47
124 0.4
125 0.3
126 0.21
127 0.13
128 0.08
129 0.08
130 0.09
131 0.09
132 0.1
133 0.12
134 0.12
135 0.13
136 0.13
137 0.13
138 0.16
139 0.2
140 0.19
141 0.19
142 0.18
143 0.2
144 0.19
145 0.18
146 0.14
147 0.13
148 0.13
149 0.12
150 0.13
151 0.13
152 0.14
153 0.14
154 0.12
155 0.1
156 0.11
157 0.16
158 0.18
159 0.17
160 0.16
161 0.16
162 0.17
163 0.17
164 0.17
165 0.14
166 0.15
167 0.14
168 0.15
169 0.15
170 0.14
171 0.13
172 0.13
173 0.1
174 0.08
175 0.08
176 0.07
177 0.08
178 0.09
179 0.09
180 0.08
181 0.08
182 0.07
183 0.07
184 0.07
185 0.06
186 0.06
187 0.06
188 0.06
189 0.1
190 0.12
191 0.12
192 0.15
193 0.16
194 0.19
195 0.21
196 0.23
197 0.28
198 0.37
199 0.47
200 0.52
201 0.6
202 0.62
203 0.63
204 0.69
205 0.66
206 0.63
207 0.64
208 0.66
209 0.64
210 0.61
211 0.6
212 0.56
213 0.56
214 0.51
215 0.45
216 0.38
217 0.33
218 0.32
219 0.32
220 0.37
221 0.36
222 0.36
223 0.39
224 0.4
225 0.43
226 0.44
227 0.52
228 0.49
229 0.51
230 0.52
231 0.48
232 0.45
233 0.4
234 0.4
235 0.38
236 0.36
237 0.28
238 0.27
239 0.26
240 0.25
241 0.24
242 0.22
243 0.17
244 0.14
245 0.14
246 0.12
247 0.11
248 0.1
249 0.11
250 0.11
251 0.08
252 0.08
253 0.07
254 0.08
255 0.07
256 0.07
257 0.06
258 0.07
259 0.07
260 0.07
261 0.07
262 0.09
263 0.09
264 0.12
265 0.11
266 0.1
267 0.12
268 0.13
269 0.15
270 0.13
271 0.13
272 0.11
273 0.13
274 0.12
275 0.11
276 0.1
277 0.08
278 0.08