Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9DGZ7

Protein Details
Accession E9DGZ7   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MVSQQKKREKKKKYYQEEITETEHydrophilic
NLS Segment(s)
PositionSequence
6-12KKREKKK
Subcellular Location(s) nucl 21, cyto_nucl 12.833, mito 3, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MVSQQKKREKKKKYYQEEITETENKVQQNKKIEFKNNNSSPVPEKMEKDDFEIVMFSDENNKKNNKIDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.89
3 0.88
4 0.83
5 0.75
6 0.69
7 0.61
8 0.52
9 0.45
10 0.38
11 0.3
12 0.31
13 0.31
14 0.3
15 0.36
16 0.4
17 0.44
18 0.47
19 0.54
20 0.55
21 0.59
22 0.64
23 0.58
24 0.58
25 0.52
26 0.48
27 0.43
28 0.4
29 0.38
30 0.31
31 0.29
32 0.3
33 0.35
34 0.33
35 0.34
36 0.32
37 0.26
38 0.24
39 0.23
40 0.18
41 0.14
42 0.14
43 0.09
44 0.17
45 0.2
46 0.23
47 0.28
48 0.31
49 0.33
50 0.41