Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3E8P4

Protein Details
Accession A0A0C3E8P4    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-25DSTRNRRESHTKPKEVQPLFHydrophilic
27-56TKTLDFDRKRLPQPPRKKRTRPAPVTPALSHydrophilic
NLS Segment(s)
PositionSequence
34-48RKRLPQPPRKKRTRP
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MGSLSDSTRNRRESHTKPKEVQPLFTTKTLDFDRKRLPQPPRKKRTRPAPVTPALSFDPKQNRIRSGRQDPAPPTPTSSCITPSDSSNGGSYEEPSAFTFSGAPQEAHYAFQHQPVYDSAPHKRPRVFSGPTHSYSGTSSTEMNSNLAEYDSPLSCTSSSSPATSDQSPTHFSDNVGCDGFNCQLQPTPEVLCPSYSYSNAAYGGVSNETQLYTRDPGVLPYPIPYHEPNYAGVTPNTAPPRNWPPPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.7
3 0.71
4 0.73
5 0.8
6 0.82
7 0.75
8 0.7
9 0.64
10 0.61
11 0.56
12 0.53
13 0.48
14 0.37
15 0.41
16 0.4
17 0.44
18 0.39
19 0.41
20 0.47
21 0.52
22 0.58
23 0.6
24 0.66
25 0.67
26 0.76
27 0.81
28 0.82
29 0.85
30 0.9
31 0.91
32 0.91
33 0.92
34 0.9
35 0.88
36 0.87
37 0.83
38 0.78
39 0.68
40 0.61
41 0.52
42 0.47
43 0.38
44 0.35
45 0.37
46 0.39
47 0.46
48 0.46
49 0.51
50 0.53
51 0.6
52 0.63
53 0.63
54 0.64
55 0.61
56 0.64
57 0.61
58 0.63
59 0.58
60 0.49
61 0.45
62 0.38
63 0.37
64 0.32
65 0.29
66 0.24
67 0.22
68 0.25
69 0.22
70 0.22
71 0.22
72 0.21
73 0.21
74 0.19
75 0.17
76 0.15
77 0.14
78 0.13
79 0.12
80 0.11
81 0.11
82 0.11
83 0.12
84 0.11
85 0.11
86 0.1
87 0.08
88 0.12
89 0.11
90 0.11
91 0.1
92 0.12
93 0.12
94 0.14
95 0.14
96 0.14
97 0.14
98 0.18
99 0.18
100 0.16
101 0.17
102 0.16
103 0.19
104 0.18
105 0.21
106 0.21
107 0.27
108 0.32
109 0.34
110 0.36
111 0.35
112 0.37
113 0.41
114 0.41
115 0.36
116 0.4
117 0.42
118 0.41
119 0.42
120 0.36
121 0.3
122 0.27
123 0.26
124 0.19
125 0.14
126 0.13
127 0.11
128 0.13
129 0.13
130 0.13
131 0.1
132 0.09
133 0.08
134 0.08
135 0.07
136 0.06
137 0.07
138 0.07
139 0.09
140 0.09
141 0.1
142 0.1
143 0.11
144 0.12
145 0.14
146 0.15
147 0.14
148 0.15
149 0.17
150 0.2
151 0.2
152 0.21
153 0.18
154 0.2
155 0.23
156 0.24
157 0.24
158 0.22
159 0.21
160 0.23
161 0.24
162 0.24
163 0.21
164 0.18
165 0.16
166 0.18
167 0.18
168 0.14
169 0.12
170 0.1
171 0.13
172 0.14
173 0.16
174 0.15
175 0.17
176 0.18
177 0.2
178 0.2
179 0.18
180 0.19
181 0.21
182 0.22
183 0.2
184 0.21
185 0.19
186 0.2
187 0.2
188 0.18
189 0.14
190 0.12
191 0.13
192 0.12
193 0.11
194 0.09
195 0.09
196 0.1
197 0.1
198 0.11
199 0.13
200 0.14
201 0.15
202 0.17
203 0.17
204 0.19
205 0.22
206 0.22
207 0.19
208 0.2
209 0.21
210 0.2
211 0.24
212 0.24
213 0.25
214 0.27
215 0.28
216 0.27
217 0.31
218 0.31
219 0.3
220 0.28
221 0.27
222 0.24
223 0.3
224 0.35
225 0.31
226 0.3
227 0.35
228 0.45