Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3DXX6

Protein Details
Accession A0A0C3DXX6    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
8-35ATSSGGKAAKKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
11-29SGGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 12, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKAAATSSGGKAAKKKKWSKGKVKDKAQHAVVLDKPTFDRIMKEVPTFRFISQSILIERLKINGSLARTAIRHLEKEGSIKRIVHHSSQLVYSRVTAAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.41
3 0.45
4 0.51
5 0.6
6 0.63
7 0.73
8 0.81
9 0.84
10 0.86
11 0.9
12 0.9
13 0.91
14 0.88
15 0.84
16 0.81
17 0.71
18 0.63
19 0.53
20 0.48
21 0.4
22 0.37
23 0.3
24 0.24
25 0.22
26 0.2
27 0.2
28 0.16
29 0.15
30 0.12
31 0.17
32 0.18
33 0.2
34 0.22
35 0.22
36 0.25
37 0.25
38 0.23
39 0.21
40 0.2
41 0.21
42 0.18
43 0.18
44 0.15
45 0.18
46 0.17
47 0.16
48 0.16
49 0.14
50 0.14
51 0.12
52 0.13
53 0.11
54 0.13
55 0.13
56 0.14
57 0.14
58 0.14
59 0.15
60 0.2
61 0.2
62 0.2
63 0.21
64 0.24
65 0.23
66 0.31
67 0.34
68 0.31
69 0.32
70 0.32
71 0.32
72 0.37
73 0.39
74 0.35
75 0.37
76 0.36
77 0.35
78 0.38
79 0.4
80 0.34
81 0.31
82 0.28