Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3E4I6

Protein Details
Accession A0A0C3E4I6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
15-38DFLFKRNPTKRSPTKRNPTNCNLAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, plas 7, golg 4, E.R. 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSHTRRPLHLEPLWDFLFKRNPTKRSPTKRNPTNCNLAVDRRTFVYATCALNSAISIGLMAIIYMSGQAKIHQMPRCGYVQCYLWQYCSQVWLQLPPCSFCFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.35
3 0.31
4 0.37
5 0.34
6 0.41
7 0.44
8 0.47
9 0.53
10 0.63
11 0.69
12 0.71
13 0.78
14 0.79
15 0.82
16 0.86
17 0.88
18 0.86
19 0.81
20 0.79
21 0.71
22 0.65
23 0.56
24 0.52
25 0.46
26 0.39
27 0.34
28 0.26
29 0.24
30 0.19
31 0.17
32 0.16
33 0.16
34 0.15
35 0.15
36 0.15
37 0.13
38 0.13
39 0.13
40 0.09
41 0.06
42 0.05
43 0.04
44 0.03
45 0.03
46 0.03
47 0.03
48 0.02
49 0.02
50 0.02
51 0.03
52 0.03
53 0.04
54 0.04
55 0.05
56 0.08
57 0.11
58 0.17
59 0.21
60 0.24
61 0.25
62 0.28
63 0.31
64 0.29
65 0.28
66 0.25
67 0.23
68 0.24
69 0.28
70 0.26
71 0.25
72 0.26
73 0.27
74 0.25
75 0.25
76 0.22
77 0.21
78 0.22
79 0.26
80 0.28
81 0.3
82 0.32
83 0.32