Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3ARV1

Protein Details
Accession A0A0C3ARV1    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
53-73GCLNRLCRRRRAPAVQRVSICHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 10.166, nucl 10, mito 10, cyto_nucl 8.833
Family & Domain DBs
Amino Acid Sequences MYSYTKMQTGNAGWVRGGLKASGPDPPRICPTVWELGSIVSSVGEEWGGMSIGCLNRLCRRRRAPAVQRVSICNIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.23
4 0.22
5 0.13
6 0.12
7 0.13
8 0.14
9 0.18
10 0.19
11 0.24
12 0.25
13 0.27
14 0.29
15 0.29
16 0.29
17 0.24
18 0.26
19 0.27
20 0.25
21 0.24
22 0.2
23 0.18
24 0.18
25 0.16
26 0.12
27 0.05
28 0.05
29 0.04
30 0.04
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.06
39 0.07
40 0.09
41 0.1
42 0.12
43 0.2
44 0.28
45 0.33
46 0.4
47 0.48
48 0.56
49 0.65
50 0.73
51 0.76
52 0.79
53 0.83
54 0.8
55 0.76
56 0.7