Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2ZRV5

Protein Details
Accession A0A0C2ZRV5    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MPEILKRKPRDPPKITPAKRRKIGVBasic
NLS Segment(s)
PositionSequence
6-22KRKPRDPPKITPAKRRK
Subcellular Location(s) nucl 21.5, mito_nucl 13.5, mito 4.5
Family & Domain DBs
Amino Acid Sequences MPEILKRKPRDPPKITPAKRRKIGVDINNGPRTSAQLPKTSSRQNLTLSDWMTVYSIVDLYPNVSQADIVWHFSTLATASGKTGNAIVHYLCPLLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.84
4 0.84
5 0.83
6 0.82
7 0.76
8 0.7
9 0.67
10 0.69
11 0.66
12 0.66
13 0.63
14 0.65
15 0.65
16 0.61
17 0.53
18 0.43
19 0.39
20 0.32
21 0.31
22 0.25
23 0.26
24 0.3
25 0.33
26 0.38
27 0.39
28 0.4
29 0.36
30 0.36
31 0.33
32 0.33
33 0.32
34 0.3
35 0.26
36 0.23
37 0.2
38 0.17
39 0.14
40 0.12
41 0.09
42 0.05
43 0.05
44 0.04
45 0.04
46 0.04
47 0.05
48 0.06
49 0.07
50 0.07
51 0.07
52 0.07
53 0.06
54 0.12
55 0.11
56 0.14
57 0.13
58 0.13
59 0.14
60 0.14
61 0.14
62 0.09
63 0.11
64 0.09
65 0.09
66 0.1
67 0.12
68 0.12
69 0.12
70 0.13
71 0.12
72 0.12
73 0.13
74 0.13
75 0.13
76 0.14